RegulonDB RegulonDB 10.8: Gene Form
   

fdx gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscA fdx iscX TSS_2826 TSS_2826 TSS_2825 TSS_2825 iscXp3 iscXp3 TSS_2824 TSS_2824 TSS_2823 TSS_2823

Gene      
Name: fdx    Texpresso search in the literature
Synonym(s): ECK2522, EG11328, b2525
Genome position(nucleotides): 2656748 <-- 2657083 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.79
External database links:  
ASAP:
ABE-0008311
CGSC:
32984
ECHOBASE:
EB1304
OU-MICROARRAY:
b2525
PortEco:
fdx
STRING:
511145.b2525
COLOMBOS: fdx


Product      
Name: reduced ferredoxin
Synonym(s): Fdx
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.331
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
14 -> 92 PDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVT
77 -> 77 W
8 -> 8 P
63 -> 63 P
68 -> 69 QE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0016226 - iron-sulfur cluster assembly
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Kim JH., et al., 2013
[2] Nakamura M., et al., 1999
[3] Ta DT., et al., 1992
[4] Tanaka N., et al., 2016
[5] Tokumoto U., et al., 2004
[6] Tokumoto U., et al., 2002
[7] Vetter H., et al., 1971
[8] Yan R., et al., 2015
External database links:  
DIP:
DIP-48512N
ECOCYC:
FERREDOXIN-MONOMER
ECOLIWIKI:
b2525
INTERPRO:
IPR001055
INTERPRO:
IPR036010
INTERPRO:
IPR018298
INTERPRO:
IPR012675
INTERPRO:
IPR011536
INTERPRO:
IPR001041
PANTHER:
PTHR23426:SF8
PDB:
1I7H
PFAM:
PF00111
PRIDE:
P0A9R4
PRINTS:
PR00355
PRODB:
PRO_000022588
PROSITE:
PS51085
PROSITE:
PS00814
REFSEQ:
NP_417020
SMR:
P0A9R4
UNIPROT:
P0A9R4


Operon      
Name: hscBA-fdx-iscX         
Operon arrangement:
Transcription unit        Promoter
hscBA-fdx-iscX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2823 2656567 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_2824 2656727 reverse nd [RS-EPT-CBR] [9]
  promoter iscXp3 2656917 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_2825 2658287 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_2826 2658293 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kim JH., Frederick RO., Reinen NM., Troupis AT., Markley JL., 2013, [2Fe-2S]-ferredoxin binds directly to cysteine desulfurase and supplies an electron for iron-sulfur cluster assembly but is displaced by the scaffold protein or bacterial frataxin., J Am Chem Soc 135(22):8117-20

 [2] Nakamura M., Saeki K., Takahashi Y., 1999, Hyperproduction of recombinant ferredoxins in escherichia coli by coexpression of the ORF1-ORF2-iscS-iscU-iscA-hscB-hs cA-fdx-ORF3 gene cluster., J Biochem (Tokyo) 126(1):10-8

 [3] Ta DT., Seaton BL., Vickery LE., 1992, Localization of the ferredoxin (fdx) gene on the physical map of the Escherichia coli chromosome., J Bacteriol 174(17):5760-1

 [4] Tanaka N., Kanazawa M., Tonosaki K., Yokoyama N., Kuzuyama T., Takahashi Y., 2016, Novel features of the ISC machinery revealed by characterization of Escherichia coli mutants that survive without iron-sulfur clusters., Mol Microbiol 99(5):835-48

 [5] Tokumoto U., Kitamura S., Fukuyama K., Takahashi Y., 2004, Interchangeability and distinct properties of bacterial Fe-S cluster assembly systems: functional replacement of the isc and suf operons in Escherichia coli with the nifSU-like operon from Helicobacter pylori., J Biochem (Tokyo) 136(2):199-209

 [6] Tokumoto U., Nomura S., Minami Y., Mihara H., Kato S., Kurihara T., Esaki N., Kanazawa H., Matsubara H., Takahashi Y., 2002, Network of protein-protein interactions among iron-sulfur cluster assembly proteins in Escherichia coli., J Biochem (Tokyo) 131(5):713-9

 [7] Vetter H., Knappe J., 1971, Flavodoxin and ferredoxin of Escherichia coli., Hoppe Seylers Z Physiol Chem 352(3):433-46

 [8] Yan R., Adinolfi S., Pastore A., 2015, Ferredoxin, in conjunction with NADPH and ferredoxin-NADP reductase, transfers electrons to the IscS/IscU complex to promote iron-sulfur cluster assembly., Biochim Biophys Acta 1854(9):1113-7

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB