RegulonDB RegulonDB 10.9: Gene Form
   

hflD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purB mnmA hflD PurR TSS_1477 TSS_1477 TSS_1476 TSS_1476 hflDp hflDp TSS_1475 TSS_1475

Gene      
Name: hflD    Texpresso search in the literature
Synonym(s): ECK1118, EG11345, b1132, hslZ, ycfC
Genome position(nucleotides): 1191990 <-- 1192631 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.17
External database links:  
ASAP:
ABE-0003812
ECHOBASE:
EB1321
ECOLIHUB:
hflD
OU-MICROARRAY:
b1132
STRING:
511145.b1132
COLOMBOS: hflD


Product      
Name: lysogenization regulator
Synonym(s): HflD, HslZ, YcfC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 22.948
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
7 -> 199 DITLALAGICQSARLVQQLAHQGHCDADALHVSLNSIIDMNPSSTLAVFGGSEANLRVGLETLLGVLNASSRQGLNAELTRYTLSLMVLERKLSSAKGALDTLGNRINGLQRQLEHFDLQSETLMSAMAAIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRATLLAGIRAAVLWHQVGGGRLQLMFSRNRLT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0009408 - response to heat
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Kihara A., et al., 2001
External database links:  
ECOCYC:
EG11345-MONOMER
ECOLIWIKI:
b1132
INTERPRO:
IPR035932
INTERPRO:
IPR007451
MODBASE:
P25746
PANTHER:
PTHR38100
PDB:
1QZ4
PDB:
1SDI
PFAM:
PF04356
PRIDE:
P25746
PRODB:
PRO_000022883
REFSEQ:
NP_415650
SMR:
P25746
UNIPROT:
P25746


Operon      
Name: hflD-purB         
Operon arrangement:
Transcription unit        Promoter
hflD-purB


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1475 1192505 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1476 1192966 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1477 1193560 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kihara A., Akiyama Y., Ito K., 2001, Revisiting the lysogenization control of bacteriophage lambda. Identification and characterization of a new host component, HflD., J Biol Chem 276(17):13695-700

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB