RegulonDB RegulonDB 10.9: Gene Form
   

waaO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaB waaO waaJ waaS SoxS MarA TSS_4210 (cluster) TSS_4210 (cluster) waaYp waaYp

Gene      
Name: waaO    Texpresso search in the literature
Synonym(s): ECK3617, EG11352, b3627, rfaI, waaI
Genome position(nucleotides): 3802039 <-- 3803058 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.18
External database links:  
ASAP:
ABE-0011860
CGSC:
17614
ECHOBASE:
EB1327
ECOLIHUB:
rfaI
NCBI-GENE:
948148
OU-MICROARRAY:
b3627
STRING:
511145.b3627
COLOMBOS: waaO


Product      
Name: UDP-D-glucose:(glucosyl)LPS α-1,3-glucosyltransferase
Synonym(s): RfaI, WaaI, WaaO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.423
Isoelectric point: 7.98
Motif(s):
 
Type Positions Sequence
31 -> 277 IAYGTDKNFLFGCGISIASILKYNEGSRLCFHIFTDYFGDDDRKYFDALALQYKTRIKIYLINGDRLRSLPSTKNWTHAIYFRFVIADYFINKAPKVLYLDADIICQGTIEPLINFSFPDDKVAMVVTEGQADWWEKRAHSLGVAGIAKGYFNSGFLLINTAQWAAQQVSARAIAMLNEPEIIKKITHPDQDVLNMLLADKLIFADIKYNTQFSLNYQLKESFINPVTNDTIFIHYIGPTKPWHDWA
131 -> 132 DA
265 -> 271 HYIGPTK
280 -> 336 YPVSQAFMEAKNASPWKNTALLKPNNSNQLRYSAKHMLKKHRYLKGFSNYLFYFIEK
34 -> 39 GTDKNF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008918 - lipopolysaccharide 3-alpha-galactosyltransferase activity
GO:0047270 - lipopolysaccharide glucosyltransferase II activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT8
DIP:
DIP-10670N
ECOCYC:
EG11352-MONOMER
ECOLIWIKI:
b3627
INTERPRO:
IPR029044
INTERPRO:
IPR002495
INTERPRO:
IPR013645
MODBASE:
P27128
PFAM:
PF01501
PFAM:
PF08437
PRIDE:
P27128
PRODB:
PRO_000023721
REFSEQ:
NP_418084
UNIPROT:
P27128


Operon      
Name: rirA-waaQGPSBOJYZU         
Operon arrangement:
Transcription unit        Promoter
rfaYZ
rfaQGPSBIJYZ-waaU
rirA-rfaQGPSBIJYZ-waaU
rfaZ-waaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4210 (cluster) 3804751 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB