RegulonDB RegulonDB 10.9: Gene Form
   

waaJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaO waaJ waaY SoxS MarA waaYp waaYp TSS_4209 TSS_4209

Gene      
Name: waaJ    Texpresso search in the literature
Synonym(s): ECK3616, EG11353, b3626, rfaJ, waaR
Genome position(nucleotides): 3800983 <-- 3801999 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
33.82
External database links:  
ASAP:
ABE-0011858
CGSC:
17611
ECHOBASE:
EB1328
ECOLIHUB:
rfaJ
NCBI-GENE:
948142
OU-MICROARRAY:
b3626
STRING:
511145.b3626
COLOMBOS: waaJ


Product      
Name: UDP-glucose:(glucosyl)LPS α-1,2-glucosyltransferase
Synonym(s): RfaJ, UDP-D-glucose:(galactosyl)lipopolysaccharide glucosyltransferase, WaaJ, WaaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.04
Isoelectric point: 9.077
Motif(s):
 
Type Positions Sequence
33 -> 38 GVDANY
215 -> 215 D
278 -> 334 YPSVKYYKIALENSPWKDDSPRDAKSIIEFKKRYKHLLVQHHYISGIIAGVCYLCRK
29 -> 276 NVAYGVDANYLDGVGVSITSIVLNNRHINLDFYIIADVYNDGFFQKIAKLAEQNQLRITLYRINTDKLQCLPCTQVWSRAMYFRLFAFQLLGLTLDRLLYLDADVVCKGDISQLLHLGLNGAVAAVVKDVEPMQEKAVSRLSDPELLGQYFNSGVVYLDLKKWADAKLTEKALSILMSKDNVYKYPDQDVMNVLLKGMTLFLPREYNTIYTIKSELKDKTHQNYKKLITESTLLIHYTGATKPWHKWA
130 -> 130 D

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008918 - lipopolysaccharide 3-alpha-galactosyltransferase activity
GO:0008919 - lipopolysaccharide glucosyltransferase I activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Parker CT., et al., 1992
External database links:  
CAZY:
GT8
DIP:
DIP-10671N
ECOCYC:
EG11353-MONOMER
ECOLIWIKI:
b3626
INTERPRO:
IPR002495
INTERPRO:
IPR013645
INTERPRO:
IPR029044
MODBASE:
P27129
PFAM:
PF08437
PFAM:
PF01501
PRIDE:
P27129
PRODB:
PRO_000023722
REFSEQ:
NP_418083
SMR:
P27129
UNIPROT:
P27129


Operon      
Name: rirA-waaQGPSBOJYZU         
Operon arrangement:
Transcription unit        Promoter
rfaYZ
rfaQGPSBIJYZ-waaU
rirA-rfaQGPSBIJYZ-waaU
rfaZ-waaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4209 3800612 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Parker CT., Kloser AW., Schnaitman CA., Stein MA., Gottesman S., Gibson BW., 1992, Role of the rfaG and rfaP genes in determining the lipopolysaccharide core structure and cell surface properties of Escherichia coli K-12., J Bacteriol 174(8):2525-38

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB