RegulonDB RegulonDB 10.8: Gene Form
   

emrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrB emrA mprA terminator anti-terminator anti-anti-terminator TSS_2996 TSS_2996

Gene      
Name: emrA    Texpresso search in the literature
Synonym(s): ECK2679, EG11354, b2685
Genome position(nucleotides): 2811427 --> 2812599 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0008838
CGSC:
33259
ECHOBASE:
EB1329
OU-MICROARRAY:
b2685
PortEco:
emrA
STRING:
511145.b2685
COLOMBOS: emrA


Product      
Name: multidrug efflux pump membrane fusion protein EmrA
Synonym(s): EmrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 42.736
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
35 -> 345 AVAIGIYWFLVLRHFEETDDAYVAGNQIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSV
62 -> 62 I
25 -> 45 LLLTLLFIIIAVAIGIYWFLV
138 -> 138 K
61 -> 289 QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0048545 - response to steroid hormone
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Griffith JM., et al., 2019
[2] Hinchliffe P., et al., 2014
[3] Pu Y., et al., 2016
External database links:  
DIP:
DIP-9502N
ECOCYC:
EG11354-MONOMER
ECOLIWIKI:
b2685
INTERPRO:
IPR006143
INTERPRO:
IPR032317
INTERPRO:
IPR005694
MODBASE:
P27303
PFAM:
PF00529
PFAM:
PF16576
PRIDE:
P27303
PRODB:
PRO_000022509
PROSITE:
PS00543
REFSEQ:
NP_417170
SMR:
P27303
UNIPROT:
P27303


Operon      
Name: mprA-emrAB         
Operon arrangement:
Transcription unit        Promoter
emrRAB


Transcriptional Regulation      
Display Regulation             
Repressed by: MprA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2996 2811338 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Griffith JM., Basting PJ., Bischof KM., Wrona EP., Kunka KS., Tancredi AC., Moore JP., Hyman MRL., Slonczewski JL., 2019, Experimental Evolution of Escherichia coli K-12 in the Presence of Proton Motive Force (PMF) Uncoupler Carbonyl Cyanide m -Chlorophenylhydrazone Selects for Mutations Affecting PMF-Driven Drug Efflux Pumps., Appl Environ Microbiol 85(5)

 [2] Hinchliffe P., Greene NP., Paterson NG., Crow A., Hughes C., Koronakis V., 2014, Structure of the periplasmic adaptor protein from a major facilitator superfamily (MFS) multidrug efflux pump., FEBS Lett 588(17):3147-53

 [3] Pu Y., Zhao Z., Li Y., Zou J., Ma Q., Zhao Y., Ke Y., Zhu Y., Chen H., Baker MAB., Ge H., Sun Y., Xie XS., Bai F., 2016, Enhanced Efflux Activity Facilitates Drug Tolerance in Dormant Bacterial Cells., Mol Cell 62(2):284-294

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB