RegulonDB RegulonDB 10.7: Gene Form
   

fliZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tcyJ fliA fliZ anti-anti-terminator anti-terminator TSS_2258 TSS_2258 TSS_2257 TSS_2257 TSS_2256 (cluster) TSS_2256 (cluster) tcyJp tcyJp TSS_2254 TSS_2254 TSS_2253 TSS_2253 TSS_2252 TSS_2252 TSS_2251 TSS_2251

Gene      
Name: fliZ    Texpresso search in the literature
Synonym(s): ECK1920, EG11356, b1921, yedH
Genome position(nucleotides): 2000473 <-- 2001024 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.56
External database links:  
ASAP:
ABE-0006394
ECHOBASE:
EB1331
OU-MICROARRAY:
b1921
PORTECO:
fliZ
REGULONDB:
b1921
STRING:
511145.b1921
M3D: fliZ
COLOMBOS: fliZ
PortEco: b1921


Product      
Name: DNA-binding transcriptional regulator FliZ
Synonym(s): FliZ, YedH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.658
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
90 -> 164 IGFKQFLFEQTEMSPGTVREYVVRLRRLGNHLHEQNISLDQLQDGFLDEILAPWLPTTSTNNYRIALRKYQHYQR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016989 - sigma factor antagonist activity
GO:0001047 - core promoter binding
biological_process GO:0015074 - DNA integration
GO:1902021 - regulation of bacterial-type flagellum-dependent cell motility
GO:1903507 - negative regulation of nucleic acid-templated transcription
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Pesavento C., et al., 2008
External database links:  
ECOCYC:
EG11356-MONOMER
ECOLIWIKI:
b1921
INTERPRO:
IPR004107
INTERPRO:
IPR022523
PFAM:
PF02899
PRIDE:
P52627
PRODB:
PRO_000022671
PROTEINMODELPORTAL:
P52627
REFSEQ:
NP_416431
UNIPROT:
P52627


Operon      
Name: fliAZ-tcyJ         
Operon arrangement:
Transcription unit        Promoter
tcyJ
fliAZY
fliAZY


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, FlhDC
Repressed by: NsrR, SutR, IHF, MatA, CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2251 2000146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2252 2000154 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2253 2000191 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2254 2000398 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2256 (cluster) 2000468 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2257 2000470 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2258 2001544 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pesavento C., Becker G., Sommerfeldt N., Possling A., Tschowri N., Mehlis A., Hengge R., 2008, Inverse regulatory coordination of motility and curli-mediated adhesion in Escherichia coli., Genes Dev 22(17):2434-46

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB