RegulonDB RegulonDB 10.7: Gene Form
   

rob gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rob ytjC yjjX creA NagC SoxS Rob MarA creAp creAp robp robp creAp2 creAp2 TSS_5185 TSS_5185 TSS_5184 TSS_5184 TSS_5183 TSS_5183 yjjXp6 yjjXp6 yjjXp5 yjjXp5 TSS_5181 TSS_5181 TSS_5180 (cluster) TSS_5180 (cluster)

Gene      
Name: rob    Texpresso search in the literature
Synonym(s): ECK4388, EG11366, b4396, cbpB, robA
Genome position(nucleotides): 4634441 <-- 4635310 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.22
External database links:  
ASAP:
ABE-0014420
CGSC:
34661
ECHOBASE:
EB1340
OU-MICROARRAY:
b4396
PORTECO:
rob
REGULONDB:
b4396
STRING:
511145.b4396
M3D: rob
COLOMBOS: rob
PortEco: b4396


Product      
Name: DNA-binding transcriptional dual regulator Rob
Synonym(s): CbpB, Rob, RobA, right origin-binding protein
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 33.145
Isoelectric point: 7.19
Motif(s):
 
Type Positions Sequence
25 -> 46 DNVAAKAGYSKWHLQRMFKDVT
127 -> 288 EHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDAKAGDRPINLRCELLIPIR
8 -> 106 RDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRS
27 -> 105 VAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRR
73 -> 96 ILDIALQYRFDSQQTFTRAFKKQF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Ariza RR., et al., 1995
[2] Skarstad K., et al., 1993
External database links:  
DIP:
DIP-47868N
ECOCYC:
PD04418
ECOLIWIKI:
b4396
INTERPRO:
IPR009057
INTERPRO:
IPR010499
INTERPRO:
IPR011256
INTERPRO:
IPR020449
INTERPRO:
IPR018060
INTERPRO:
IPR018062
INTERPRO:
IPR029442
MINT:
MINT-1246646
MODBASE:
P0ACI0
PDB:
1D5Y
PFAM:
PF12833
PFAM:
PF06445
PRIDE:
P0ACI0
PRINTS:
PR00032
PRODB:
PRO_000023802
PROSITE:
PS00041
PROSITE:
PS01124
PROTEINMODELPORTAL:
P0ACI0
REFSEQ:
NP_418813
SMART:
SM00871
SMART:
SM00342
SMR:
P0ACI0
UNIPROT:
P0ACI0


Operon      
Name: rob         
Operon arrangement:
Transcription unit        Promoter
rob


Transcriptional Regulation      
Display Regulation             
Repressed by: MarA, SoxS, Rob


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5180 (cluster) 4633755 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_5181 4633764 reverse nd [RS-EPT-CBR] [3]
  promoter yjjXp5 4633773 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [3], [4]
  promoter yjjXp6 4633899 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_5183 4634537 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_5184 4634582 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_5185 4635151 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ariza RR., Li Z., Ringstad N., Demple B., 1995, Activation of multiple antibiotic resistance and binding of stress-inducible promoters by Escherichia coli Rob protein., J Bacteriol 177(7):1655-61

 [2] Skarstad K., Thony B., Hwang DS., Kornberg A., 1993, A novel binding protein of the origin of the Escherichia coli chromosome., J Biol Chem 268(8):5365-70

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB