RegulonDB RegulonDB 10.8: Gene Form
   

tadA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purL mltF pgpC tadA NsrR PurR TSS_2852 TSS_2852 mltFp mltFp purLp purLp TSS_2850 TSS_2850

Gene      
Name: tadA    Texpresso search in the literature
Synonym(s): ECK2557, EG11372, b2559, yfhC
Genome position(nucleotides): 2697354 <-- 2697857 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.76
External database links:  
ASAP:
ABE-0008419
ECHOBASE:
EB1346
OU-MICROARRAY:
b2559
PortEco:
tadA
STRING:
511145.b2559
COLOMBOS: tadA


Product      
Name: tRNA adenosine34 deaminase
Synonym(s): TadA, YfhC, tRNA-specific adenosine deaminase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.718
Isoelectric point: 7.702
Motif(s):
 
Type Positions Sequence
6 -> 117 FSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSL
53 -> 53 D
7 -> 153 SHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMRR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0052718 - tRNA-specific adenosine-34 deaminase complex
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008251 - tRNA-specific adenosine deaminase activity
GO:0008270 - zinc ion binding
GO:0042803 - protein homodimerization activity
GO:0052717 - tRNA-specific adenosine-34 deaminase activity
biological_process GO:0006382 - adenosine to inosine editing
GO:0008033 - tRNA processing
GO:0002100 - tRNA wobble adenosine to inosine editing
Note(s): Note(s): ...[more].
Reference(s): [1] Elias Y., et al., 2005
[2] Poulsen LK., et al., 1992
External database links:  
ECOCYC:
EG11372-MONOMER
ECOLIWIKI:
b2559
INTERPRO:
IPR028883
INTERPRO:
IPR002125
INTERPRO:
IPR016192
INTERPRO:
IPR016193
MODBASE:
P68398
PDB:
1Z3A
PFAM:
PF14437
PRIDE:
P68398
PRODB:
PRO_000024020
PROSITE:
PS00903
PROSITE:
PS51747
REFSEQ:
NP_417054
SMR:
P68398
SWISSMODEL:
P68398
UNIPROT:
P68398


Operon      
Name: pgpC-tadA         
Operon arrangement:
Transcription unit        Promoter
pgpC-tadA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2850 2694924 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2852 2697755 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Elias Y., Huang RH., 2005, Biochemical and structural studies of A-to-I editing by tRNA:A34 deaminases at the wobble position of transfer RNA., Biochemistry 44(36):12057-65

 [2] Poulsen LK., Larsen NW., Molin S., Andersson P., 1992, Analysis of an Escherichia coli mutant strain resistant to the cell-killing function encoded by the gef gene family., Mol Microbiol 6(7):895-905

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB