RegulonDB RegulonDB 10.8: Gene Form
   

folK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pcnB gluQ yadN folK DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp ppGpp ppGpp pcnBp4 pcnBp4 pcnBp2 pcnBp2 pcnBp3 pcnBp3 pcnBp1 pcnBp1 yadNp7 yadNp7 yadNp8 yadNp8 yadNp1 yadNp1

Gene      
Name: folK    Texpresso search in the literature
Synonym(s): ECK0141, EG11374, b0142
Genome position(nucleotides): 157253 <-- 157732 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0000491
CGSC:
29572
ECHOBASE:
EB1348
OU-MICROARRAY:
b0142
PortEco:
folK
STRING:
511145.b0142
COLOMBOS: folK


Product      
Name: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Synonym(s): FolK, HPPK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.079
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
2 -> 159 TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
5 -> 134 YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003848 - 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity
GO:0000287 - magnesium ion binding
biological_process GO:0009396 - folic acid-containing compound biosynthetic process
GO:0046656 - folic acid biosynthetic process
GO:0016310 - phosphorylation
GO:0046654 - tetrahydrofolate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
H2PTERIDINEPYROPHOSPHOKIN-MONOMER
ECOLIWIKI:
b0142
ECOO157CYC:
FOLK-MONOMER
INTERPRO:
IPR035907
INTERPRO:
IPR000550
MODBASE:
P26281
PDB:
1F9H
PDB:
1EX8
PDB:
1HKA
PDB:
1HQ2
PDB:
1IM6
PDB:
1KBR
PDB:
1Q0N
PDB:
1RAO
PDB:
1RB0
PDB:
1RTZ
PDB:
1RU1
PDB:
1RU2
PDB:
1TMJ
PDB:
1TMM
PDB:
2F63
PDB:
2F65
PDB:
3HCX
PDB:
3HD1
PDB:
3HD2
PDB:
3HSD
PDB:
3HSG
PDB:
3HSJ
PDB:
3HSZ
PDB:
3HT0
PDB:
3ILI
PDB:
3ILJ
PDB:
3ILL
PDB:
3ILO
PDB:
3IP0
PDB:
3KUE
PDB:
3KUG
PDB:
3KUH
PDB:
3UD5
PDB:
3UDE
PDB:
3UDV
PDB:
4F7V
PDB:
4M5G
PDB:
4M5H
PDB:
4M5I
PDB:
4M5J
PDB:
4M5K
PDB:
4M5L
PDB:
4M5M
PDB:
4M5N
PDB:
5ETK
PDB:
5ETL
PDB:
5ETM
PDB:
5ETN
PDB:
5ETO
PDB:
5ETP
PDB:
6AN4
PDB:
6AN6
PDB:
1EQM
PDB:
1EQ0
PDB:
1G4C
PDB:
1DY3
PFAM:
PF01288
PRIDE:
P26281
PRODB:
PRO_000022680
PROSITE:
PS00794
REFSEQ:
NP_414684
SMR:
P26281
UNIPROT:
P26281


Operon      
Name: pcnB-folK         
Operon arrangement:
Transcription unit        Promoter
pcnB-folK
pcnB-folK
pcnB-folK
pcnB-folk


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadNp1 156984 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yadNp8 157031 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yadNp7 157055 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB