RegulonDB RegulonDB 10.8: Gene Form
   

appB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

appC appB appX

Gene      
Name: appB    Texpresso search in the literature
Synonym(s): ECK0970, EG11379, b0979, cbdB, cyxB
Genome position(nucleotides): 1039296 --> 1040432 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0003302
CGSC:
31813
ECHOBASE:
EB1353
OU-MICROARRAY:
b0979
PortEco:
appB
STRING:
511145.b0979
COLOMBOS: appB


Product      
Name: cytochrome bd-II ubiquinol oxidase subunit II
Synonym(s): AppB, CbdB, CyxB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.424
Isoelectric point: 8.682
Motif(s):
 
Type Positions Sequence
7 -> 361 LRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGNQVWLILAGGALFAAWPRVYAAAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWDAGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMVILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWLWVGIDGFVLLAQDANGPSNPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFGVIFTAGITLFPFVMPSSVSPISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYKM
262 -> 281 PVLWIFPLLGFFCPLLTVMA
80 -> 99 AAAFSGFYVAMILVLCSLFF
123 -> 142 LVIGSLVPPVVFGIAFGNLL
206 -> 225 RAALLVMLCFLLAGYWLWVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0070069 - cytochrome complex
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016682 - oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
biological_process GO:0006119 - oxidative phosphorylation
GO:0019646 - aerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Lobritz MA., et al., 2015
External database links:  
ECOCYC:
APPB-MONOMER
ECOLIWIKI:
b0979
ECOO157CYC:
APPB-MONOMER
INTERPRO:
IPR003317
PANTHER:
PTHR43141
PFAM:
PF02322
PRIDE:
P26458
PRODB:
PRO_000022110
REFSEQ:
NP_415498
UNIPROT:
P26458


Operon      
Name: appCBXA         
Operon arrangement:
Transcription unit        Promoter
appCBA-yccB
appA


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lobritz MA., Belenky P., Porter CB., Gutierrez A., Yang JH., Schwarz EG., Dwyer DJ., Khalil AS., Collins JJ., 2015, Antibiotic efficacy is linked to bacterial cellular respiration., Proc Natl Acad Sci U S A 112(27):8173-80


RegulonDB