RegulonDB RegulonDB 10.9: Gene Form
   

uspA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uspA uspB yriA yriB FadR FadR IHF ppGpp ppGpp TSS_4101 (cluster) TSS_4101 (cluster) TSS_4100 (cluster) TSS_4100 (cluster) TSS_4099 TSS_4099 TSS_4098 TSS_4098 TSS_4097 (cluster) TSS_4097 (cluster) TSS_4096 (cluster) TSS_4096 (cluster) TSS_4095 (cluster) TSS_4095 (cluster) uspAp3 uspAp3 uspAp2 uspAp2 TSS_4093 (cluster) TSS_4093 (cluster) uspAp1 uspAp1 TSS_4092 (cluster) TSS_4092 (cluster) uspBp uspBp TSS_4091 TSS_4091

Gene      
Name: uspA    Texpresso search in the literature
Synonym(s): ECK3480, EG11390, b3495
Genome position(nucleotides): 3640111 --> 3640545 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.2
External database links:  
ASAP:
ABE-0011414
CGSC:
28127
ECHOBASE:
EB1363
ECOLIHUB:
uspA
OU-MICROARRAY:
b3495
STRING:
511145.b3495
COLOMBOS: uspA


Product      
Name: universal stress global stress response regulator
Synonym(s): UspA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.066
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
3 -> 138 YKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSDLYTGLIDVNLGDMQKRISEETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVP
140 -> 140 R
2 -> 144 AYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSDLYTGLIDVNLGDMQKRISEETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-36230N
ECOCYC:
EG11390-MONOMER
ECOLIWIKI:
b3495
INTERPRO:
IPR006015
INTERPRO:
IPR006016
INTERPRO:
IPR014729
MODBASE:
P0AED0
PANTHER:
PTHR46268
PFAM:
PF00582
PRIDE:
P0AED0
PRODB:
PRO_000024190
REFSEQ:
NP_417952
SMR:
P0AED0
SWISSMODEL:
P0AED0
UNIPROT:
P0AED0


Operon      
Name: uspA         
Operon arrangement:
Transcription unit        Promoter
uspA
uspA
uspA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4091 3639846 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4092 (cluster) 3639937 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4093 (cluster) 3639984 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4095 (cluster) 3640090 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4096 (cluster) 3640126 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4097 (cluster) 3640211 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4098 3640229 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4099 3640413 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4100 (cluster) 3640418 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4101 (cluster) 3640424 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB