RegulonDB RegulonDB 10.6.3: Gene Form
   

osmY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prfC osmY ytjA Fis CRP CRP IHF Fis CRP IHF Lrp Lrp terminator anti-terminator anti-anti-terminator terminator osmYp osmYp

Gene      
Name: osmY    Texpresso search in the literature
Synonym(s): ECK4367, EG11391, b4376, csi-5
Genome position(nucleotides): 4611396 --> 4612001 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.65
External database links:  
ASAP:
ABE-0014348
CGSC:
34640
ECHOBASE:
EB1364
ECOCYC:
EG11391
ECOLIHUB:
osmY
OU-MICROARRAY:
b4376
REGULONDB:
b4376
STRING:
511145.b4376
M3D: osmY
COLOMBOS: osmY
PortEco: b4376


Shine dalgarno      
Sequence: gcaaacatacAGGAATaaatcgATG


Product      
Name: periplasmic chaperone OsmY
Synonym(s): OsmY
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 21.074
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
55 -> 123 DDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRD
135 -> 199 DTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLK
1 -> 28 MTMTRLKISKTLLAVMLTSAVATGSAYA
29 -> 201 ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK
134 -> 201 GDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
biological_process GO:0006970 - response to osmotic stress
GO:0006972 - hyperosmotic response
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Ding Q., et al., 1995
[2] Lange R., et al., 1993
[3] Lee SJ., et al., 2004
[4] Lennon CW., et al., 2015
[5] Weichart D., et al., 1993
[6] Xia XX., et al., 2008
[7] Yim HH., et al., 1992
External database links:  
DIP:
DIP-47968N
ECOCYC:
EG11391-MONOMER
ECOLIWIKI:
b4376
INTERPRO:
IPR007055
INTERPRO:
IPR014004
PFAM:
PF04972
PRIDE:
P0AFH8
PRODB:
PRO_000023470
PROSITE:
PS50914
PROTEINMODELPORTAL:
P0AFH8
REFSEQ:
NP_418793
SMART:
SM00749
SMR:
P0AFH8
UNIPROT:
P0AFH8


Operon      
Name: osmY         
Operon arrangement:
Transcription unit        Promoter
osmY


Transcriptional Regulation      
Display Regulation             
Repressed by: FliZ, CRP, IHF, Lrp, Fis
Growth Conditions:

[1] 

C: Escherichia coli| protox assay
E: Escherichia coli| chenodeoxycholate; protox assay

[2] 

C: Escherichia coli| protox assay
E: Escherichia coli| protox assay; ursodeoxycholate

[3] 

C: Escherichia coli| protox assay
E: Escherichia coli| glycocholate; protox assay

[4] 

C: Escherichia coli| protox assay
E: Escherichia coli| deoxycholate; protox assay



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ding Q., Kusano S., Villarejo M., Ishihama A., 1995, Promoter selectivity control of Escherichia coli RNA polymerase by ionic strength: differential recognition of osmoregulated promoters by E sigma D and E sigma S holoenzymes., Mol Microbiol 16(4):649-56

 [2] Lange R., Barth M., Hengge-Aronis R., 1993, Complex transcriptional control of the sigma s-dependent stationary-phase-induced and osmotically regulated osmY (csi-5) gene suggests novel roles for Lrp, cyclic AMP (cAMP) receptor protein-cAMP complex, and integration host factor in the stationary-phase response of Escherichia coli., J Bacteriol 175(24):7910-7

 [3] Lee SJ., Gralla JD., 2004, Osmo-regulation of bacterial transcription via poised RNA polymerase., Mol Cell 14(2):153-62

 [4] Lennon CW., Thamsen M., Friman ET., Cacciaglia A., Sachsenhauser V., Sorgenfrei FA., Wasik MA., Bardwell JC., 2015, Folding Optimization In Vivo Uncovers New Chaperones., J Mol Biol 427(18):2983-94

 [5] Weichart D., Lange R., Henneberg N., Hengge-Aronis R., 1993, Identification and characterization of stationary phase-inducible genes in Escherichia coli., Mol Microbiol 10(2):407-20

 [6] Xia XX., Han MJ., Lee SY., Yoo JS., 2008, Comparison of the extracellular proteomes of Escherichia coli B and K-12 strains during high cell density cultivation., Proteomics 8(10):2089-103

 [7] Yim HH., Villarejo M., 1992, osmY, a new hyperosmotically inducible gene, encodes a periplasmic protein in Escherichia coli., J Bacteriol 174(11):3637-44


RegulonDB