RegulonDB RegulonDB 10.8: Gene Form
   

psiF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phoA dgcC psiF CsgD CsgD terminator anti-terminator adrAp adrAp psiFp psiFp

Gene      
Name: psiF    Texpresso search in the literature
Synonym(s): ECK0379, EG11401, b0384
Genome position(nucleotides): 403281 --> 403601 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.66
External database links:  
ASAP:
ABE-0001330
CGSC:
18013
ECHOBASE:
EB1373
OU-MICROARRAY:
b0384
PortEco:
psiF
STRING:
511145.b0384
COLOMBOS: psiF


Product      
Name: PsiF family protein
Synonym(s): PsiF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.687
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
27 -> 59 TPQQQRMTSCNQQATAQALKGDARKTYMSDCLK
21 -> 106 AAERTLTPQQQRMTSCNQQATAQALKGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKKAA
71 -> 103 TPQQQKMRECNNQATQQSLKGDDRNKFMSACLK
1 -> 20 MKITLLVTLLFGLVFLTTVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Chang CN., et al., 1986
External database links:  
ECOCYC:
EG11401-MONOMER
ECOLIWIKI:
b0384
INTERPRO:
IPR011690
PFAM:
PF07769
PRIDE:
P0AFM4
PRODB:
PRO_000023613
REFSEQ:
NP_414918
UNIPROT:
P0AFM4


Operon      
Name: phoA-psiF         
Operon arrangement:
Transcription unit        Promoter
phoA-psiF
psiF


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chang CN., Kuang WJ., Chen EY., 1986, Nucleotide sequence of the alkaline phosphatase gene of Escherichia coli., Gene 44(1):121-5


RegulonDB