RegulonDB RegulonDB 10.7: Gene Form
   

ychF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgV ychF pth OxyR OxyR ychFp ychFp ycgVp10 ycgVp10 ycgVp9 ycgVp9

Gene      
Name: ychF    Texpresso search in the literature
Synonym(s): ECK1191, EG11404, b1203, gtp1
Genome position(nucleotides): 1256721 <-- 1257812 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.01
External database links:  
ASAP:
ABE-0004038
ECHOBASE:
EB1376
OU-MICROARRAY:
b1203
PORTECO:
ychF
REGULONDB:
b1203
STRING:
511145.b1203
M3D: ychF
COLOMBOS: ychF
PortEco: b1203


Product      
Name: redox-responsive ATPase YchF
Synonym(s): YchF, ribosome-binding ATPase YchF, ribosome-binding ATPase, inhibitor of catalase activity
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.667
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
3 -> 256 FKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRTLPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVSGKVNPADDIEVINTELALADLDTCERAIHRVQKKAKGGDKDAKAELAVLEKCLPQLENAGMLRALDLSAEEKAAIRYLSFLTLKPTMYIANVNEDGFENNPYLDQVREIAAKEGSVVVPVCAAVEADIAELDDEERDEFM
12 -> 17 NVGKST
279 -> 362 LQTYFTAGVKEVRAWTIPVGATAPQAAGKIHTDFEKGFIRAQTISFEDFITYKGEQGAKEAGKMRAEGKDYIVKDGDVMNFLFN
5 -> 113 CGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRTLPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENDNII
278 -> 361 NLQTYFTAGVKEVRAWTIPVGATAPQAAGKIHTDFEKGFIRAQTISFEDFITYKGEQGAKEAGKMRAEGKDYIVKDGDVMNFLF

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0043022 - ribosome binding
GO:0046872 - metal ion binding
GO:0004857 - enzyme inhibitor activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005525 - GTP binding
GO:0042803 - protein homodimerization activity
GO:0043023 - ribosomal large subunit binding
biological_process GO:0006979 - response to oxidative stress
GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11404-MONOMER
ECOLIWIKI:
b1203
INTERPRO:
IPR027417
INTERPRO:
IPR041706
INTERPRO:
IPR031167
INTERPRO:
IPR023192
INTERPRO:
IPR004396
INTERPRO:
IPR006073
INTERPRO:
IPR012675
INTERPRO:
IPR012676
INTERPRO:
IPR013029
MODBASE:
P0ABU2
PANTHER:
PTHR23305:SF4
PFAM:
PF06071
PFAM:
PF01926
PRIDE:
P0ABU2
PRINTS:
PR00326
PRODB:
PRO_000022517
PROSITE:
PS51880
PROSITE:
PS51710
PROTEINMODELPORTAL:
P0ABU2
REFSEQ:
NP_415721
SMR:
P0ABU2
SWISSMODEL:
P0ABU2
UNIPROT:
P0ABU2


Operon      
Name: pth-ychF         
Operon arrangement:
Transcription unit        Promoter
ychF
pth-ychF


Transcriptional Regulation      
Display Regulation             
Repressed by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgVp9 1256110 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycgVp10 1256111 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB