RegulonDB RegulonDB 10.8: Gene Form
   

lpxK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaI msbA ycaQ lpxK TSS_1189 TSS_1189

Gene      
Name: lpxK    Texpresso search in the literature
Synonym(s): ECK0906, EG11409, b0915, ycaH
Genome position(nucleotides): 968366 --> 969352 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.71
External database links:  
ASAP:
ABE-0003115
ECHOBASE:
EB1381
OU-MICROARRAY:
b0915
PortEco:
lpxK
STRING:
511145.b0915
COLOMBOS: lpxK


Product      
Name: tetraacyldisaccharide 4'-kinase
Synonym(s): LpxK, YcaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 35.589
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
55 -> 62 TAGGNGKT
13 -> 319 WRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAPVAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGVRRFGNGWWLPAGPMRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGHPPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENWWYLPVDAQLSGDEPAKLLT
158 -> 158 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.5 - K antigen
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009029 - tetraacyldisaccharide 4'-kinase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Hampton RY., et al., 1992
External database links:  
DIP:
DIP-10126N
ECOCYC:
TETRAACYLDISACC4KIN-MONOMER
ECOLIWIKI:
b0915
INTERPRO:
IPR027417
INTERPRO:
IPR003758
PANTHER:
PTHR42724
PFAM:
PF02606
PRIDE:
P27300
PRODB:
PRO_000023125
REFSEQ:
NP_415435
SMR:
P27300
UNIPROT:
P27300


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1189 966594 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hampton RY., Raetz CR., 1992, Lipid A 4'-kinase from Escherichia coli: enzyme assay and preparation of 4'-32P-labeled probes of high specific radioactivity., Methods Enzymol 209:466-75

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB