RegulonDB RegulonDB 10.9: Gene Form
   

holC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

valS pepA yjgN holC holCp holCp TSS_5107 TSS_5107 TSS_5106 TSS_5106 valSp1 valSp1 valSp2 valSp2 TSS_5103 TSS_5103

Gene      
Name: holC    Texpresso search in the literature
Synonym(s): ECK4252, EG11413, b4259
Genome position(nucleotides): 4483837 <-- 4484280 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
External database links:  
ASAP:
ABE-0013948
CGSC:
31456
ECHOBASE:
EB1385
ECOLIHUB:
holC
OU-MICROARRAY:
b4259
STRING:
511145.b4259
COLOMBOS: holC


Product      
Name: DNA polymerase III subunit χ
Synonym(s): HolC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.633
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
1 -> 141 MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0043847 - DNA polymerase III, clamp loader chi/psi subcomplex
molecular_function GO:0003677 - DNA binding
GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
biological_process GO:0006260 - DNA replication
GO:0009314 - response to radiation
GO:0071897 - DNA biosynthetic process
GO:0032298 - positive regulation of DNA-dependent DNA replication initiation
Reference(s): [1] Carter JR., et al., 1993
[2] Sargentini NJ., et al., 2016
[3] Watanabe K., et al., 2016
[4] Xiao H., et al., 1993
External database links:  
DIP:
DIP-9933N
ECOCYC:
EG11413-MONOMER
ECOLIWIKI:
b4259
INTERPRO:
IPR007459
INTERPRO:
IPR036768
MINT:
P28905
MODBASE:
P28905
PANTHER:
PTHR38767
PDB:
3SXU
PDB:
1EM8
PFAM:
PF04364
PRIDE:
P28905
PRODB:
PRO_000022918
REFSEQ:
NP_418680
SMR:
P28905
UNIPROT:
P28905


Operon      
Name: holC-valS         
Operon arrangement:
Transcription unit        Promoter
valS
valS
holC-valS
holC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5103 4483498 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_5106 4483936 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_5107 4483996 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Carter JR., Franden MA., Lippincott JA., McHenry CS., 1993, Identification, molecular cloning and characterization of the gene encoding the chi subunit of DNA polymerase III holoenzyme of Escherichia coli., Mol Gen Genet 241(3-4):399-408

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [3] Watanabe K., Tominaga K., Kitamura M., Kato JI., 2016, Systematic identification of synthetic lethal mutations with reduced-genome Escherichia coli: synthetic genetic interactions among yoaA, xthA and holC related to survival from MMS exposure., Genes Genet Syst 91(3):183-188

 [4] Xiao H., Crombie R., Dong Z., Onrust R., O'Donnell M., 1993, DNA polymerase III accessory proteins. III. holC and holD encoding chi and psi., J Biol Chem 268(16):11773-8

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB