RegulonDB RegulonDB 10.8: Gene Form
   

cynR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

codA cynR cynT codB CynR CynR cynTp cynTp cynRp cynRp

Gene      
Name: cynR    Texpresso search in the literature
Synonym(s): ECK0335, EG11421, b0338
Genome position(nucleotides): 357791 <-- 358690 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.0
External database links:  
ASAP:
ABE-0001165
CGSC:
31255
ECHOBASE:
EB1391
OU-MICROARRAY:
b0338
PortEco:
cynR
STRING:
511145.b0338
COLOMBOS: cynR


Shine dalgarno      
Sequence: ggatttacttATAGGTtgcgAAT


Product      
Name: DNA-binding transcriptional dual regulator CynR
Synonym(s): CynR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 32.961
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
1 -> 58 MLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSGRTIRLT
88 -> 290 LTRGSLRIAVTPTFTSYFIGPLMADFYARYPSITLQLQEMSQEKIEDMLCRDELDVGIAFAPVHSPELEAIPLLTESLALVVAQHHPLAVHEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEANSISAVLELIRRTSLSTLLPAAIATQHDGLKAISLAPPLLERTAVLLRRKNSWQTAAAKAFLHMALDKC
4 -> 62 RHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSGRTIRLTDAGE
18 -> 37 FTRAASALHVSQPALSQQIR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Reference(s): [1] Lamblin AF., et al., 1994
[2] Lamblin AF., et al., 1993
[3] Sung YC., et al., 1992
External database links:  
DIP:
DIP-9364N
ECOCYC:
PD00291
ECOLIWIKI:
b0338
INTERPRO:
IPR036388
INTERPRO:
IPR037403
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P27111
PDB:
2HXR
PDB:
3HFU
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P27111
PRINTS:
PR00039
PRODB:
PRO_000022365
PROSITE:
PS50931
REFSEQ:
NP_414872
SMR:
P27111
UNIPROT:
P27111


Operon      
Name: cynR         
Operon arrangement:
Transcription unit        Promoter
cynR


Transcriptional Regulation      
Display Regulation             
Repressed by: CynR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lamblin AF., Fuchs JA., 1994, Functional analysis of the Escherichia coli K-12 cyn operon transcriptional regulation., J Bacteriol 176(21):6613-22

 [2] Lamblin AF., Fuchs JA., 1993, Expression and purification of the cynR regulatory gene product: CynR is a DNA-binding protein., J Bacteriol 175(24):7990-9

 [3] Sung YC., Fuchs JA., 1992, The Escherichia coli K-12 cyn operon is positively regulated by a member of the lysR family., J Bacteriol 174(11):3645-50


RegulonDB