RegulonDB RegulonDB 10.9: Gene Form
   

sthA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sthA oxyR fabR oxyS OxyR OxyR terminator terminator TSS_4692 TSS_4692 TSS_4691 TSS_4691 TSS_4690 TSS_4690 TSS_4689 TSS_4689 TSS_4688 TSS_4688 sthAp sthAp oxyRp oxyRp oxySp oxySp

Gene      
Name: sthA    Texpresso search in the literature
Synonym(s): ECK3954, EG11428, b3962, sth, udhA
Genome position(nucleotides): 4159390 <-- 4160790 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.82
External database links:  
ASAP:
ABE-0012975
ECHOBASE:
EB1398
ECOLIHUB:
sthA
OU-MICROARRAY:
b3962
STRING:
511145.b3962
COLOMBOS: sthA


Product      
Name: soluble pyridine nucleotide transhydrogenase
Synonym(s): Sth, SthA, UdhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.56
Isoelectric point: 6.547
Motif(s):
 
Type Positions Sequence
7 -> 326 YDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTHPRIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQTAQPHVYAVGDVIGYPSLASAAYDQG
36 -> 45 ERYQNVGGGC
118 -> 118 R
2 -> 466 PHSYDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTHPRIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQTAQPHVYAVGDVIGYPSLASAAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF
346 -> 457 IPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0003957 - NAD(P)+ transhydrogenase (B-specific) activity
GO:0008746 - NAD(P)+ transhydrogenase activity
GO:0004148 - dihydrolipoyl dehydrogenase activity
GO:0042802 - identical protein binding
biological_process GO:0006739 - NADP metabolic process
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Almstetter MF., et al., 2009
[2] Holm AK., et al., 2010
[3] Jan J., et al., 2013
External database links:  
ECOCYC:
UDHA-MONOMER
ECOLIWIKI:
b3962
INTERPRO:
IPR036188
INTERPRO:
IPR023753
INTERPRO:
IPR001100
INTERPRO:
IPR004099
INTERPRO:
IPR016156
INTERPRO:
IPR022962
MODBASE:
P27306
PFAM:
PF02852
PFAM:
PF07992
PRIDE:
P27306
PRODB:
PRO_000024000
REFSEQ:
NP_418397
SMR:
P27306
UNIPROT:
P27306


Operon      
Name: sthA         
Operon arrangement:
Transcription unit        Promoter
sthA


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4688 4161094 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4689 4161458 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4690 4161554 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4691 4161556 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4692 4161745 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Almstetter MF., Appel IJ., Gruber MA., Lottaz C., Timischl B., Spang R., Dettmer K., Oefner PJ., 2009, Integrative normalization and comparative analysis for metabolic fingerprinting by comprehensive two-dimensional gas chromatography-time-of-flight mass spectrometry., Anal Chem 81(14):5731-9

 [2] Holm AK., Blank LM., Oldiges M., Schmid A., Solem C., Jensen PR., Vemuri GN., 2010, Metabolic and transcriptional response to cofactor perturbations in Escherichia coli., J Biol Chem 285(23):17498-506

 [3] Jan J., Martinez I., Wang Y., Bennett GN., San KY., 2013, Metabolic engineering and transhydrogenase effects on NADPH availability in escherichia coli., Biotechnol Prog

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB