RegulonDB RegulonDB 10.8: Gene Form
   

yfeC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeD yfeC alaW Fis terminator TSS_2681 (cluster) TSS_2681 (cluster) yfeCp yfeCp yfeCp3 yfeCp3 yfeCp4 yfeCp4 yfeCp5 yfeCp5 alaXp4 alaXp4 alaXp2 alaXp2 alaXp5 alaXp5 alaWp alaWp

Gene      
Name: yfeC    Texpresso search in the literature
Synonym(s): ECK2392, EG11431, b2398
Genome position(nucleotides): 2518467 --> 2518811 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.14
External database links:  
ASAP:
ABE-0007907
ECHOBASE:
EB1401
OU-MICROARRAY:
b2398
PortEco:
yfeC
STRING:
511145.b2398
COLOMBOS: yfeC


Product      
Name: putative DNA-binding transcriptional regulator YfeC
Synonym(s): YfeC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.72
Isoelectric point: 10.043
Motif(s):
 
Type Positions Sequence
40 -> 76 RLVHVNEQVREYIRNAERPEGQGEAPALSGDAPLEVL
1 -> 113 MTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNAERPEGQGEAPALSGDAPLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDS

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12012N
ECOCYC:
EG11431-MONOMER
ECOLIWIKI:
b2398
INTERPRO:
IPR010749
INTERPRO:
IPR009061
MODBASE:
P0AD37
PFAM:
PF07037
PRIDE:
P0AD37
PRODOM:
PD060594
REFSEQ:
NP_416897
SMR:
P0AD37
UNIPROT:
P0AD37


Operon      
Name: yfeCD         
Operon arrangement:
Transcription unit        Promoter
yfeCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter alaXp5 2518259 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter alaXp2 2518279 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter alaXp4 2518306 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfeCp5 2518334 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfeCp4 2518375 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfeCp3 2518384 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2681 (cluster) 2518419 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB