RegulonDB RegulonDB 10.8: Gene Form
   

yfeD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gltX yfeD yfeC TSS_2682 TSS_2682

Gene      
Name: yfeD    Texpresso search in the literature
Synonym(s): ECK2393, EG11432, b2399
Genome position(nucleotides): 2518813 --> 2519205 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.06
External database links:  
ASAP:
ABE-0007909
ECHOBASE:
EB1402
OU-MICROARRAY:
b2399
PortEco:
yfeD
STRING:
511145.b2399
COLOMBOS: yfeD


Product      
Name: putative DNA-binding transcriptional regulator YfeD
Synonym(s): YfeD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.91
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
8 -> 129 MTTEELAECLGVAKQTVNRWIREKGWKTEKFPGVKGGRARLILVDTQVCEFIQNTPAFHNTPMLMEAEERIAEYAPGARAPAYRQIINAIDNMTDIEQEKVAQFLSREGIRNFLARLDIDES

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12013N
ECOCYC:
EG11432-MONOMER
ECOLIWIKI:
b2399
INTERPRO:
IPR010749
INTERPRO:
IPR009061
INTERPRO:
IPR001387
INTERPRO:
IPR010982
PFAM:
PF07037
PRIDE:
P27238
PRODOM:
PD060594
REFSEQ:
NP_416898
SMR:
P27238
UNIPROT:
P27238


Operon      
Name: yfeCD         
Operon arrangement:
Transcription unit        Promoter
yfeCD


RNA cis-regulatory element    
   
Cis-reg RtT RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2682 2519911 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB