RegulonDB RegulonDB 10.8: Gene Form
   

marA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

marR marA marB

Gene      
Name: marA    Texpresso search in the literature
Synonym(s): ECK1524, EG11434, b1531, cfxB, inaR, nfxC, norB, soxQ
Genome position(nucleotides): 1619574 --> 1619957 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
Note(s):
Sodium salicylate (NaSal), acetyl salicylic acid (ASA), acetaminophen (APAP), and ibuprofen contribute to antibiotic resistance by inducing the expression of both marA and acrB genes 30304479 The induction by NaSal, ASA, and APAP is relatively higher and is partly dependent on marA, whereas ibuprofen, which induces lower antibiotic resistance, shows complete marA dependence. NaSal, ASA, APAP, and ibuprofen induce antibiotic resistance in an acrB-dependent manner 30304479
External database links:  
ASAP:
ABE-0005112
CGSC:
18172
ECHOBASE:
EB1404
OU-MICROARRAY:
b1531
PortEco:
marA
STRING:
511145.b1531
COLOMBOS: marA


Product      
Name: DNA-binding transcriptional dual regulator MarA
Synonym(s): CfxB, InaR, MarA, NfxC, NorB, SoxQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 15.184
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence
77 -> 100 ILYLAERYGFESQQTLTRTFKNYF
12 -> 110 HSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMT
32 -> 108 SERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYR
29 -> 50 EKVSERSGYSKWHLQRMFKKET

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0001217 - DNA-binding transcription repressor activity
GO:0000985 - bacterial-type RNA polymerase core promoter sequence-specific DNA binding
biological_process GO:0036245 - cellular response to menadione
GO:0072756 - cellular response to paraquat
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Alon Cudkowicz N., et al., 2019
[2] Cohen SP., et al., 1993
[3] Gambino L., et al., 1993
[4] Jair KW., et al., 1995
[5] Jindal S., et al., 2019
[6] Pu Y., et al., 2016
External database links:  
DIP:
DIP-48136N
ECOCYC:
PD00365
ECOLIWIKI:
b1531
INTERPRO:
IPR009057
INTERPRO:
IPR018062
INTERPRO:
IPR018060
MINT:
MINT-1251059
MODBASE:
P0ACH5
PDB:
1XS9
PDB:
1BL0
PFAM:
PF12833
PRIDE:
P0ACH5
PRODB:
PRO_000023166
PROSITE:
PS00041
PROSITE:
PS01124
REFSEQ:
NP_416048
SMART:
SM00342
SMR:
P0ACH5
UNIPROT:
P0ACH5


Operon      
Name: marRAB         
Operon arrangement:
Transcription unit        Promoter
marRAB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, CRP, CpxR, Rob, SoxS, Fis
Repressed by: Cra, AcrR, MarR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Alon Cudkowicz N., Schuldiner S., 2019, Deletion of the major Escherichia coli multidrug transporter AcrB reveals transporter plasticity and redundancy in bacterial cells., PLoS One 14(6):e0218828

 [2] Cohen SP., Hachler H., Levy SB., 1993, Genetic and functional analysis of the multiple antibiotic resistance (mar) locus in Escherichia coli., J Bacteriol 175(5):1484-92

 [3] Gambino L., Gracheck SJ., Miller PF., 1993, Overexpression of the MarA positive regulator is sufficient to confer multiple antibiotic resistance in Escherichia coli., J Bacteriol 175(10):2888-94

 [4] Jair KW., Martin RG., Rosner JL., Fujita N., Ishihama A., Wolf RE., 1995, Purification and regulatory properties of MarA protein, a transcriptional activator of Escherichia coli multiple antibiotic and superoxide resistance promoters., J Bacteriol 177(24):7100-4

 [5] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [6] Pu Y., Zhao Z., Li Y., Zou J., Ma Q., Zhao Y., Ke Y., Zhu Y., Chen H., Baker MAB., Ge H., Sun Y., Xie XS., Bai F., 2016, Enhanced Efflux Activity Facilitates Drug Tolerance in Dormant Bacterial Cells., Mol Cell 62(2):284-294


RegulonDB