RegulonDB RegulonDB 10.7: Gene Form
   

marR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

marC marR marA MarR MarR CpxR AcrR CRP SoxS Rob MarA Cra Fis marRp marRp marCp marCp

Gene      
Name: marR    Texpresso search in the literature
Synonym(s): ECK1523, EG11435, b1530, cfxB, inaR, soxQ
Genome position(nucleotides): 1619120 --> 1619554 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.43
External database links:  
ASAP:
ABE-0005110
CGSC:
30935
ECHOBASE:
EB1405
OU-MICROARRAY:
b1530
PORTECO:
marR
REGULONDB:
b1530
STRING:
511145.b1530
M3D: marR
COLOMBOS: marR
PortEco: b1530


Shine dalgarno      
Sequence: attacttgccAGGGCAactaatGTG


Product      
Name: DNA-binding transcriptional repressor MarR
Synonym(s): CfxB, InaR, MarR, SoxQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MarR
Cellular location: cytosol
Molecular weight: 16.065
Isoelectric point: 8.375
Motif(s):
 
Type Positions Sequence
77 -> 77 R
123 -> 144 LTKNLTADEVATLEYLLKKVLP
38 -> 96 ITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGV
45 -> 45 V
11 -> 144 IIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009408 - response to heat
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
GO:0071236 - cellular response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Ariza RR., et al., 1994
[2] Cohen SP., et al., 1993
[3] Sulavik MC., et al., 1995
External database links:  
DIP:
DIP-10164N
ECOCYC:
PD00364
ECOLIWIKI:
b1530
INTERPRO:
IPR036388
INTERPRO:
IPR023187
INTERPRO:
IPR000835
INTERPRO:
IPR036390
MODBASE:
P27245
PDB:
5H3R
PDB:
4JBA
PDB:
3VOE
PDB:
3VOD
PDB:
3VB2
PDB:
1JGS
PFAM:
PF01047
PRIDE:
P27245
PRINTS:
PR00598
PRODB:
PRO_000023167
PROSITE:
PS01117
PROSITE:
PS50995
PROTEINMODELPORTAL:
P27245
REFSEQ:
NP_416047
SMART:
SM00347
SMR:
P27245
UNIPROT:
P27245


Operon      
Name: marRAB         
Operon arrangement:
Transcription unit        Promoter
marRAB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, CRP, CpxR, Rob, SoxS, Fis
Repressed by: Cra, AcrR, MarR
Growth Conditions:

[1] 

C: Escherichia coli| sodium salicylate 5 mM
E: Escherichia coli| paraquat 500 µM; sodium salicylate 5 mM

[2] 

C: Escherichia coli| marA knockout mutant; marB knockout mutant; marR knockout mutant
E: Escherichia coli| marA knockout mutant; marB knockout mutant; marR knockout mutant| sodium salicylate 5 mM



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ariza RR., Cohen SP., Bachhawat N., Levy SB., Demple B., 1994, Repressor mutations in the marRAB operon that activate oxidative stress genes and multiple antibiotic resistance in Escherichia coli., J Bacteriol 176(1):143-8

 [2] Cohen SP., Hachler H., Levy SB., 1993, Genetic and functional analysis of the multiple antibiotic resistance (mar) locus in Escherichia coli., J Bacteriol 175(5):1484-92

 [3] Sulavik MC., Gambino LF., Miller PF., 1995, The MarR repressor of the multiple antibiotic resistance (mar) operon in Escherichia coli: prototypic member of a family of bacterial regulatory proteins involved in sensing phenolic compounds., Mol Med 1(4):436-46


RegulonDB