RegulonDB RegulonDB 10.8: Gene Form
   

plsX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

plsX fabH rpmF FadR DksA-ppGpp DksA-ppGpp TSS_1392 TSS_1392 TSS_1391 TSS_1391 TSS_1390 TSS_1390 TSS_1389 TSS_1389 fabHp fabHp TSS_1388 TSS_1388 TSS_1387 TSS_1387 plsXp plsXp TSS_1386 (cluster) TSS_1386 (cluster)

Gene      
Name: plsX    Texpresso search in the literature
Synonym(s): ECK1076, EG11437, b1090
Genome position(nucleotides): 1147621 --> 1148691 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.1
External database links:  
ASAP:
ABE-0003692
CGSC:
18046
ECHOBASE:
EB1407
OU-MICROARRAY:
b1090
PortEco:
plsX
STRING:
511145.b1090
COLOMBOS: plsX


Product      
Name: putative phosphate acyltransferase
Synonym(s): PlsX, fatty acid/phospholipid synthesis protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.214
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
5 -> 331 TLALDVMGGDFGPSVTVPAALQALNSNSQLTLLLVGNSDAITPLLAKADFEQRSRLQIIPAQSVIASDARPSQAIRASRGSSMRVALELVKEGRAQACVSAGNTGALMGLAKLLLKPLEGIERPALVTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAIMGSVLAEEVVEIPNPRVALLNIGEEEVKGLDSIRDASAVLKTIPSINYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNPDQYNGACLLGLRGTVIKSHGAANQRAFAVAIEQAVQAVQRQVPQR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0043811 - phosphate:acyl-[acyl carrier protein] acyltransferase activity
GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
biological_process GO:0006629 - lipid metabolic process
GO:0006644 - phospholipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0006633 - fatty acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Larson TJ., et al., 1984
External database links:  
DIP:
DIP-10517N
ECOCYC:
EG11437-MONOMER
ECOLIWIKI:
b1090
INTERPRO:
IPR012281
INTERPRO:
IPR003664
MODBASE:
P27247
PANTHER:
PTHR30100
PFAM:
PF02504
PRIDE:
P27247
PRODB:
PRO_000023557
REFSEQ:
NP_415608
SMR:
P27247
UNIPROT:
P27247


Operon      
Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter
yceD-rpmF
yceD-rpmF
rpmF-plsX-fabHDG
plsX-fabHDG
fabHDG
acpP
acpP-fabF
fabDG-acpP
fabF
fabG-acpP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1386 (cluster) 1147395 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1387 1147771 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1388 1148362 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1389 1149153 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1390 1149156 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1391 1149172 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1392 1149706 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Larson TJ., Ludtke DN., Bell RM., 1984, sn-Glycerol-3-phosphate auxotrophy of plsB strains of Escherichia coli: evidence that a second mutation, plsX, is required., J Bacteriol 160(2):711-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB