RegulonDB RegulonDB 10.8: Gene Form
   

emrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrB emrA luxS CyaR terminator anti-terminator anti-anti-terminator

Gene      
Name: emrB    Texpresso search in the literature
Synonym(s): ECK2680, EG11439, b2686
Genome position(nucleotides): 2812616 --> 2814154 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.6
External database links:  
ASAP:
ABE-0008840
CGSC:
33262
ECHOBASE:
EB1409
OU-MICROARRAY:
b2686
PortEco:
emrB
STRING:
511145.b2686
COLOMBOS: emrB


Product      
Name: multidrug efflux pump membrane subunit EmrB
Synonym(s): EmrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.624
Isoelectric point: 8.039
Motif(s):
 
Type Positions Sequence
19 -> 413 LSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNFTIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIG
203 -> 223 AVGLALLVIGIGSLQIMLDRG
13 -> 38 VIMTIALSLATFMQVLDSTIANVAIP
110 -> 128 VIQGIVAGPLIPLSQSLLL
482 -> 504 WMSAGIFLVLLGLVWFAKPPFGA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0015299 - solute:proton antiporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0048545 - response to steroid hormone
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Furukawa H., et al., 1993
[2] Pu Y., et al., 2016
External database links:  
ECOCYC:
EMRB-MONOMER
ECOLIWIKI:
b2686
INTERPRO:
IPR004638
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR011701
INTERPRO:
IPR001411
MODBASE:
P0AEJ0
PANTHER:
PTHR23501
PFAM:
PF07690
PRIDE:
P0AEJ0
PRODB:
PRO_000022510
PROSITE:
PS50850
REFSEQ:
NP_417171
SMR:
P0AEJ0
UNIPROT:
P0AEJ0


Operon      
Name: mprA-emrAB         
Operon arrangement:
Transcription unit        Promoter
emrRAB


Transcriptional Regulation      
Display Regulation             
Repressed by: MprA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Furukawa H., Tsay JT., Jackowski S., Takamura Y., Rock CO., 1993, Thiolactomycin resistance in Escherichia coli is associated with the multidrug resistance efflux pump encoded by emrAB., J Bacteriol 175(12):3723-9

 [2] Pu Y., Zhao Z., Li Y., Zou J., Ma Q., Zhao Y., Ke Y., Zhu Y., Chen H., Baker MAB., Ge H., Sun Y., Xie XS., Bai F., 2016, Enhanced Efflux Activity Facilitates Drug Tolerance in Dormant Bacterial Cells., Mol Cell 62(2):284-294


RegulonDB