RegulonDB RegulonDB 10.8: Gene Form
   

gcvT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcvT gcvH yqfI GcvA GcvA Lrp CRP GcvA GcvA PurR gcvTp gcvTp

Gene      
Name: gcvT    Texpresso search in the literature
Synonym(s): ECK2900, EG11442, b2905
Genome position(nucleotides): 3049573 <-- 3050667 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0009536
CGSC:
28667
ECHOBASE:
EB1412
MIM:
605899
NCBI-GENE:
947390
OU-MICROARRAY:
b2905
PortEco:
gcvT
STRING:
511145.b2905
COLOMBOS: gcvT


Product      
Name: aminomethyltransferase
Synonym(s): GcvT, T-protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.147
Isoelectric point: 5.27
Motif(s):
 
Type Positions Sequence
280 -> 357 KLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFV
7 -> 254 LYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDETISPLAANMGWT
2 -> 364 AQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNGKAVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0004047 - aminomethyltransferase activity
biological_process GO:0009257 - 10-formyltetrahydrofolate biosynthetic process
GO:0006546 - glycine catabolic process
GO:0019464 - glycine decarboxylation via glycine cleavage system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GCVT-MONOMER
ECOLIWIKI:
b2905
INTERPRO:
IPR028896
INTERPRO:
IPR029043
INTERPRO:
IPR027266
INTERPRO:
IPR022903
INTERPRO:
IPR013977
INTERPRO:
IPR006223
INTERPRO:
IPR006222
MODBASE:
P27248
PANTHER:
PTHR13847:SF5
PDB:
3A8K
PDB:
3A8J
PDB:
3A8I
PDB:
1VLO
PFAM:
PF08669
PFAM:
PF01571
PRIDE:
P27248
PRODB:
PRO_000022766
REFSEQ:
NP_417381
SMR:
P27248
UNIPROT:
P27248


Operon      
Name: gcvTHP         
Operon arrangement:
Transcription unit        Promoter
gcvTHP
gcvP


Transcriptional Regulation      
Display Regulation             
Activated by: GcvA, CRP, FNR, Lrp
Repressed by: PurR, GcvA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB