RegulonDB RegulonDB 11.0: Gene Form
   

rarD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rarD yigI yigG terminator rarDp5 rarDp5 rarDp3 rarDp3 rarDp4 rarDp4 rarDp2 rarDp2 rarDp1 rarDp1 yigFp4 yigFp4 yigFp5 yigFp5

Gene      
Name: rarD    Texpresso search in the literature
Synonym(s): ECK3813, EG11466, b3819, yigH
Genome position(nucleotides): 4003288 <-- 4004178
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
External database links:  
ASAP:
ABE-0012472
ECHOBASE:
EB1434
ECOLIHUB:
rarD
OU-MICROARRAY:
b3819
STRING:
511145.b3819
COLOMBOS: rarD


Product      
Name: putative transporter RarD
Synonym(s): RarD, YigH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.283
Isoelectric point: 9.882
Motif(s):
 
Type Positions Sequence Comment
9 -> 142 GVLLALAAYFIWGIAPAYFKLIYYVPADEILTHRVIWSFFFMVVLMSICRQWSYLKTLIQTPQKIFMLAVSAVLIGGNWLLFIWAVNNHHMLEASLGYFINPLVNIVLGMIFLGERFRRMQWLAVILAICGVLV
12 -> 34 LALAAYFIWGIAPAYFKLIYYVP UniProt: Helical.
18 -> 145 FIWGIAPAYFKLIYYVPADEILTHRVIWSFFFMVVLMSICRQWSYLKTLIQTPQKIFMLAVSAVLIGGNWLLFIWAVNNHHMLEASLGYFINPLVNIVLGMIFLGERFRRMQWLAVILAICGVLVQLW UniProt: EamA.
38 -> 60 ILTHRVIWSFFFMVVLMSICRQW UniProt: Helical.
73 -> 95 IFMLAVSAVLIGGNWLLFIWAVN UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P27844
ECOCYC:
EG11466-MONOMER
ECOLIWIKI:
b3819
INTERPRO:
IPR000620
INTERPRO:
IPR004626
PANTHER:
PTHR22911:SF114
PFAM:
PF00892
PRIDE:
P27844
PRODB:
PRO_000023679
REFSEQ:
YP_026262
UNIPROT:
P27844


Operon      
Name: rarD         
Operon arrangement:
Transcription unit        Promoter
rarD


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yigFp5 4002842 reverse nd [ICWHO] [1]
  promoter yigFp4 4002875 reverse nd [ICWHO] [1]
  promoter rarDp1 4004227 reverse nd [ICWHO] [1]
  promoter rarDp2 4004231 reverse nd [ICWHO] [1]
  promoter rarDp4 4004241 reverse nd [ICWHO] [1]
  promoter rarDp3 4004258 reverse nd [ICWHO] [1]
  promoter rarDp5 4004297 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB