RegulonDB RegulonDB 10.8: Gene Form
   

ubiJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ubiB ubiE ubiJ esrE anti-terminator anti-anti-terminator TSS_4508 TSS_4508 esrEp esrEp

Gene      
Name: ubiJ    Texpresso search in the literature
Synonym(s): ECK3828, EG11474, b3834, yigP
Genome position(nucleotides): 4019624 --> 4020229 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.78
External database links:  
ASAP:
ABE-0012536
ECHOBASE:
EB1442
OU-MICROARRAY:
b3834
PortEco:
yigP
STRING:
511145.b3834
COLOMBOS: ubiJ


Product      
Name: ubiquinone biosynthesis accessory factor UbiJ
Synonym(s): UbiJ, YigP, conserved protein involved in ubiquinone-8 biosynthesis UbiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.153
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
119 -> 139 PAELLAPYTGDIAAEGISKAM
15 -> 112 LNTFLYRSPALKTARSRLLGKVLRVEVKGFSTSLILVFSERQVDVLGEWAGDADCTVIAYASVLPKLRDRQQLTALIRSGELEVQGDIQVVQNFVALA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0110142 - ubiquinone biosynthesis complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0032150 - ubiquinone biosynthetic process from chorismate
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Aussel L., et al., 2014
[2] Wang Y., et al., 2012
[3] Xia H., et al., 2017
[4] Xia H., et al., 2017
External database links:  
ECOCYC:
EG11474-MONOMER
ECOLIWIKI:
b3834
INTERPRO:
IPR038989
INTERPRO:
IPR036527
INTERPRO:
IPR003033
PANTHER:
PTHR38693
PDB:
6H6O
PDB:
6H6N
PDB:
6H6P
PFAM:
PF02036
PRIDE:
P0ADP7
REFSEQ:
NP_418278
SMR:
P0ADP7
UNIPROT:
P0ADP7


Operon      
Name: ubiEJB         
Operon arrangement:
Transcription unit        Promoter
ubiE-yigP-ubiB
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4508 4021218 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4510 (cluster) 4021912 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Aussel L., Loiseau L., Hajj Chehade M., Pocachard B., Fontecave M., Pierrel F., Barras F., 2014, ubiJ, a New Gene Required for Aerobic Growth and Proliferation in Macrophage, Is Involved in Coenzyme Q Biosynthesis in Escherichia coli and Salmonella enterica Serovar Typhimurium., J Bacteriol 196(1):70-9

 [2] Wang Y., Ye J., Zhang H., 2012, [Identification of transcriptional regulatory sequences of yigP gene in Escherichia coli]., Wei Sheng Wu Xue Bao 52(5):566-72

 [3] Xia H., Tang Q., Song J., Ye J., Wu H., Zhang H., 2017, A yigP mutant strain is a small colony variant of E. coli and shows pleiotropic antibiotic resistance., Can J Microbiol 63(12):961-969

 [4] Xia H., Yang X., Tang Q., Ye J., Wu H., Zhang H., 2017, EsrE-A yigP Locus-Encoded Transcript-Is a 3' UTR sRNA Involved in the Respiratory Chain of E. coli., Front Microbiol 8:1658

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB