RegulonDB RegulonDB 10.8: Gene Form
   

mliC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

anmK pdxH mliC terminator pdxHp pdxHp TSS_1915 TSS_1915

Gene      
Name: mliC    Texpresso search in the literature
Synonym(s): ECK1635, EG11488, b1639, ydhA
Genome position(nucleotides): 1718066 <-- 1718395 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.76
External database links:  
ASAP:
ABE-0005485
ECHOBASE:
EB1451
OU-MICROARRAY:
b1639
PortEco:
mliC
STRING:
511145.b1639
COLOMBOS: mliC


Product      
Name: inhibitor of c-type lysozyme, putative lipoprotein
Synonym(s): MliC, YdhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 12.568
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
1 -> 17 MTMKKLLIIILPVLLSG
35 -> 97 YQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGDEATVYKRDRI
18 -> 109 CSAFNQLVERMQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGDEATVYKRDRIVLNNCQLQNPQR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0031241 - periplasmic side of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0060241 - lysozyme inhibitor activity
biological_process GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APP] Assay of partially-purified protein
Reference(s): [1] Callewaert L., et al., 2008
External database links:  
DIP:
DIP-11726N
ECOCYC:
EG11488-MONOMER
ECOLIWIKI:
b1639
INTERPRO:
IPR018660
INTERPRO:
IPR036328
PDB:
2F09
PFAM:
PF09864
PRIDE:
P28224
PRODB:
PRO_000023243
PROSITE:
PS51257
REFSEQ:
NP_416156
SMR:
P28224
UNIPROT:
P28224


Operon      
Name: mliC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1915 1717731 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Callewaert L., Aertsen A., Deckers D., Vanoirbeek KG., Vanderkelen L., Van Herreweghe JM., Masschalck B., Nakimbugwe D., Robben J., Michiels CW., 2008, A new family of lysozyme inhibitors contributing to lysozyme tolerance in gram-negative bacteria., PLoS Pathog 4(3):e1000019

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB