RegulonDB RegulonDB 10.6.3: Gene Form
   

csgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgA csgB csgC terminator anti-terminator anti-anti-terminator ymdAp5 ymdAp5 ymdAp ymdAp

Gene      
Name: csgA    Texpresso search in the literature
Synonym(s): ECK1028, EG11489, b1042
Genome position(nucleotides): 1104447 --> 1104902 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.1
External database links:  
ASAP:
ABE-0003537
CGSC:
30620
ECHOBASE:
EB1452
ECOCYC:
EG11489
ECOLIHUB:
csgA
OU-MICROARRAY:
b1042
REGULONDB:
b1042
STRING:
511145.b1042
M3D: csgA
COLOMBOS: csgA
PortEco: b1042


Product      
Name: curlin, major subunit
Synonym(s): CsgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 15.049
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
1 -> 22 MKLLKVAAIAAIVFSGSALAGV
21 -> 151 GVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSSVNVTQVGFGNNATAHQY
86 -> 119 DDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFG
40 -> 74 GPNSELNIYQYGGGNSALALQTDARNSDLTITQHG
7 -> 7 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.13 - fimbri, pili
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
molecular_function GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0044010 - single-species biofilm formation
GO:1990000 - amyloid fibril formation
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Chapman MR., et al., 2002
[2] Hammar M., et al., 1995
[3] Sugimoto S., et al., 2018
External database links:  
DIP:
DIP-9325N
ECOCYC:
EG11489-MONOMER
ECOLIWIKI:
b1042
INTERPRO:
IPR009742
PFAM:
PF07012
PRIDE:
P28307
PRODB:
PRO_000022336
PROTEINMODELPORTAL:
P28307
REFSEQ:
NP_415560
UNIPROT:
P28307


Operon      
Name: csgBAC         
Operon arrangement:
Transcription unit        Promoter
csgBAC
csgC


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD
Repressed by: FliZ, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymdAp5 1105225 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chapman MR., Robinson LS., Pinkner JS., Roth R., Heuser J., Hammar M., Normark S., Hultgren SJ., 2002, Role of Escherichia coli curli operons in directing amyloid fiber formation., Science 295(5556):851-5

 [2] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S., 1995, Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12., Mol Microbiol 18(4):661-70

 [3] Sugimoto S., Arita-Morioka KI., Terao A., Yamanaka K., Ogura T., Mizunoe Y., 2018, Multitasking of Hsp70 chaperone in the biogenesis of bacterial functional amyloids., Commun Biol 1:52

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB