RegulonDB RegulonDB 10.8: Gene Form
   

pabC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fabF mltG pabC tmk TSS_1418 TSS_1418 pabCp1 pabCp1 pabCp5 pabCp5 pabCp8 pabCp8 TSS_1417 TSS_1417 TSS_1416 (cluster) TSS_1416 (cluster)

Gene      
Name: pabC    Texpresso search in the literature
Synonym(s): ECK1082, EG11493, b1096
Genome position(nucleotides): 1153300 --> 1154109 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
External database links:  
ASAP:
ABE-0003709
CGSC:
31889
ECHOBASE:
EB1456
OU-MICROARRAY:
b1096
PortEco:
pabC
STRING:
511145.b1096
COLOMBOS: pabC


Product      
Name: aminodeoxychorismate lyase
Synonym(s): PabC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.715
Isoelectric point: 6.491
Motif(s):
 
Type Positions Sequence
24 -> 246 GCFTTARVIDGKVSLLSAHIQRLQDACQRLMISCDFWPQLEQEMKTLAAEQQNGVLKVVISRGSGGRGYSTLNSGPATRILSVTAYPAHYDRLRNEGITLALSPVRLGRNPHLAGIKHLNRLEQVLIRSHLEQTNADEALVLDSEGWVTECCAANLFWRKGNVVYTPRLDQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0008696 - 4-amino-4-deoxychorismate lyase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0008153 - para-aminobenzoic acid biosynthetic process
GO:0046656 - folic acid biosynthetic process
GO:0046654 - tetrahydrofolate biosynthetic process
External database links:  
DIP:
DIP-10435N
ECOCYC:
ADCLY-MONOMER
ECOLIWIKI:
b1096
INTERPRO:
IPR036038
INTERPRO:
IPR018300
INTERPRO:
IPR017824
INTERPRO:
IPR001544
MODBASE:
P28305
PANTHER:
PTHR11825
PDB:
1I2L
PDB:
1I2K
PDB:
1ET0
PFAM:
PF01063
PRIDE:
P28305
PRODB:
PRO_000023486
PROSITE:
PS00770
REFSEQ:
NP_415614
SMR:
P28305
UNIPROT:
P28305


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1416 (cluster) 1152105 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1417 1152173 forward nd [RS-EPT-CBR] [1]
  promoter pabCp8 1153093 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pabCp5 1153194 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pabCp1 1153293 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1418 1155058 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB