RegulonDB RegulonDB 10.9: Gene Form
   

yhbE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

obgE yhbE rpmA terminator TSS_3491 (cluster) TSS_3491 (cluster)

Gene      
Name: yhbE    Texpresso search in the literature
Synonym(s): ECK3173, EG11499, b3184
Genome position(nucleotides): 3331770 <-- 3332735 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.0
External database links:  
ASAP:
ABE-0010464
ECHOBASE:
EB1462
ECOLIHUB:
yhbE
OU-MICROARRAY:
b3184
STRING:
511145.b3184
COLOMBOS: yhbE


Product      
Name: putative transporter YhbE
Synonym(s): YhbE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.963
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
6 -> 26 GIGILLALTTAICWGALPIAM
279 -> 299 LNLLGYLGAFVVVAGAMYSAI
191 -> 211 LFLLYTLCTIALFPLAKPGVI
250 -> 270 AIITLTPLFTLFFSDLLSLAW
159 -> 291 WGVIFGVGAATVWVSYGVAQKVLLRRLASPQILFLLYTLCTIALFPLAKPGVIAQLSHWQLACLIFCGLNTLVGYGALAEAMARWQAAQVSAIITLTPLFTLFFSDLLSLAWPDFFARPMLNLLGYLGAFVVV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
EG11499-MONOMER
ECOLIWIKI:
b3184
INTERPRO:
IPR000620
PFAM:
PF00892
PRIDE:
P0AA73
REFSEQ:
NP_417651
UNIPROT:
P0AA73


Operon      
Name: rplU-rpmA-yhbE-obgE         
Operon arrangement:
Transcription unit        Promoter
rplU-rpmA
rplU-rpmA-yhbE-obgE
yhbE-obgE


Transcriptional Regulation      
Display Regulation             
Activated by: MlrA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3491 (cluster) 3330883 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB