RegulonDB RegulonDB 10.7: Gene Form
   

adiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adiA melR adiY anti-anti-terminator anti-terminator terminator terminator TSS_4922 TSS_4922 adiAp adiAp adiYp adiYp adiCp7 adiCp7

Gene      
Name: adiA    Texpresso search in the literature
Synonym(s): ECK4110, EG11501, adi, b4117
Genome position(nucleotides): 4338254 <-- 4340521 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.69
External database links:  
ASAP:
ABE-0013483
ECHOBASE:
EB1464
OU-MICROARRAY:
b4117
PORTECO:
adiA
REGULONDB:
b4117
STRING:
511145.b4117
M3D: adiA
COLOMBOS: adiA
PortEco: b4117


Product      
Name: arginine decarboxylase, degradative
Synonym(s): Adi, AdiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 84.425
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
140 -> 590 PPLFSALMKYSDIHEYSWAAPGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLDHTGAFGESEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQGLMLTGAKPVYMVPSRNRYGIIGPIYPQEMQPETLQKKISESPLTKDKAGQKPSYCVVTNCTYDGVCYNAKEAQDLLEKTSDRLHFDEAWYGYARFNPIYADHYAMRGEPGDHNGPTVFATHSTHKLLNALSQASYIHVREGRGAINFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMARLYKEFTADGSWFFKPWNKEVVTDPQTGKTYDFADAPTKLLTTVQDCWVMHPGESWHGFKDIPDNWSMLDPIKVSILAPGMGEDGELEETGVPAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGK
18 -> 134 GNAVERLADALSQQNVTVIKSTSFDDGFAILSSNEAIDCLMFSYQMEHPDEHQNVRQLIGKLHERQQNVPVFLLGDREKALAAMDRDLLELVDEFAWILEDTADFIAGRAVAAMTRY
75 -> 75 L
615 -> 743 MPELVEQYPDTYANMGIHDLGDTMFAWLKENNPGARLNEAYSGLPVAEVTPREAYNAIVDNNVELVSIENLPGRIAANSVIPYPPGIPMLLSGENFGDKNSPQVSYLRSLQSWDHHFPGFEHETEGTEI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0008792 - arginine decarboxylase activity
GO:0030170 - pyridoxal phosphate binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0051454 - intracellular pH elevation
GO:0006527 - arginine catabolic process
External database links:  
DIP:
DIP-2903N
ECOCYC:
ARGDECARBOXDEG-MONOMER
ECOLIWIKI:
b4117
INTERPRO:
IPR005308
INTERPRO:
IPR015424
INTERPRO:
IPR000310
INTERPRO:
IPR036633
INTERPRO:
IPR008286
INTERPRO:
IPR011193
INTERPRO:
IPR015421
INTERPRO:
IPR015422
MINT:
MINT-1241522
MODBASE:
P28629
PDB:
2VYC
PFAM:
PF01276
PFAM:
PF03711
PFAM:
PF03709
PRIDE:
P28629
PRODB:
PRO_000022058
PROSITE:
PS00703
PROTEINMODELPORTAL:
P28629
REFSEQ:
NP_418541
SMR:
P28629
UNIPROT:
P28629


Operon      
Name: adiA         
Operon arrangement:
Transcription unit        Promoter
adiA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, AdiY
Repressed by: H-NS


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4922 4340855 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB