RegulonDB RegulonDB 10.8: Gene Form
   

rcsF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proS metQ trmO rcsF anti-anti-terminator anti-terminator terminator TSS_403 TSS_403 TSS_402 TSS_402 TSS_401 TSS_401 TSS_400 TSS_400 TSS_399 TSS_399 TSS_398 TSS_398 proSp proSp TSS_397 TSS_397 yaeFp1 yaeFp1

Gene      
Name: rcsF    Texpresso search in the literature
Synonym(s): ECK0196, EG11502, b0196
Genome position(nucleotides): 219591 <-- 219995 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0000663
CGSC:
29845
ECHOBASE:
EB1465
OU-MICROARRAY:
b0196
PortEco:
rcsF
STRING:
511145.b0196
COLOMBOS: rcsF


Product      
Name: sensor lipoprotein RcsF
Synonym(s): RcsF
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space
Molecular weight: 14.163
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
84 -> 99 SIPTARKRMQINASKM
103 -> 112 AVLLHSCEVT
7 -> 7 C
46 -> 46 A
48 -> 134 PVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0106234 - outer membrane protein complex
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0036406 - anchored component of periplasmic side of cell outer membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0070299 - positive regulation of phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0035556 - intracellular signal transduction
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Asmar AT., et al., 2017
[2] Callewaert L., et al., 2009
[3] Cho SH., et al., 2014
[4] Evans KL., et al., 2013
[5] Gervais FG., et al., 1992
[6] Gupte G., et al., 1997
[7] Hagiwara D., et al., 2003
[8] Hart EM., et al., 2019
[9] Hersch SJ., et al., 2020
[10] Majdalani N., et al., 2005
[11] Majdalani N., et al., 2002
[12] Nepper JF., et al., 2019
[13] Shiba Y., et al., 2004
[14] Zhang Z., et al., 2019
External database links:  
ECOCYC:
RCSF-MONOMER
ECOLIWIKI:
b0196
INTERPRO:
IPR030852
PDB:
2Y1B
PDB:
2L8Y
PFAM:
PF16358
PRIDE:
P69411
PRODB:
PRO_000023692
PROSITE:
PS51257
REFSEQ:
NP_414738
SMR:
P69411
UNIPROT:
P69411


Operon      
Name: rcsF-trmO         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeFp1 217135 reverse Similarity to the consensus
Read more >
[ICWHO] [15]
  promoter TSS_397 218831 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_398 220022 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_399 220386 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_400 220394 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_401 220539 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_402 220543 reverse nd [RS-EPT-CBR] [16]
  promoter TSS_403 220638 forward nd [RS-EPT-CBR] [16]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Asmar AT., Ferreira JL., Cohen EJ., Cho SH., Beeby M., Hughes KT., Collet JF., 2017, Communication across the bacterial cell envelope depends on the size of the periplasm., PLoS Biol 15(12):e2004303

 [2] Callewaert L., Vanoirbeek KG., Lurquin I., Michiels CW., Aertsen A., 2009, The Rcs two-component system regulates expression of lysozyme inhibitors and is induced by exposure to lysozyme., J Bacteriol 191(6):1979-81

 [3] Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF., 2014, Detecting envelope stress by monitoring β-barrel assembly., Cell 159(7):1652-64

 [4] Evans KL., Kannan S., Li G., de Pedro MA., Young KD., 2013, Eliminating a set of four penicillin binding proteins triggers the Rcs phosphorelay and Cpx stress responses in Escherichia coli., J Bacteriol 195(19):4415-24

 [5] Gervais FG., Drapeau GR., 1992, Identification, cloning, and characterization of rcsF, a new regulator gene for exopolysaccharide synthesis that suppresses the division mutation ftsZ84 in Escherichia coli K-12., J Bacteriol 174(24):8016-22

 [6] Gupte G., Woodward C., Stout V., 1997, Isolation and characterization of rcsB mutations that affect colanic acid capsule synthesis in Escherichia coli K-12., J Bacteriol 179(13):4328-35

 [7] Hagiwara D., Sugiura M., Oshima T., Mori H., Aiba H., Yamashino T., Mizuno T., 2003, Genome-wide analyses revealing a signaling network of the RcsC-YojN-RcsB phosphorelay system in Escherichia coli., J Bacteriol 185(19):5735-46

 [8] Hart EM., Gupta M., Wuhr M., Silhavy TJ., 2019, The Synthetic Phenotype of Δ bamB Δ bamE Double Mutants Results from a Lethal Jamming of the Bam Complex by the Lipoprotein RcsF., MBio 10(3)

 [9] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol

 [10] Majdalani N., Heck M., Stout V., Gottesman S., 2005, Role of RcsF in signaling to the Rcs phosphorelay pathway in Escherichia coli., J Bacteriol 187(19):6770-8

 [11] Majdalani N., Hernandez D., Gottesman S., 2002, Regulation and mode of action of the second small RNA activator of RpoS translation, RprA., Mol Microbiol 46(3):813-26

 [12] Nepper JF., Lin YC., Weibel DB., 2019, Rcs Phosphorelay Activation in Cardiolipin-Deficient Escherichia coli Reduces Biofilm Formation., J Bacteriol 201(9)

 [13] Shiba Y., Yokoyama Y., Aono Y., Kiuchi T., Kusaka J., Matsumoto K., Hara H., 2004, Activation of the Rcs signal transduction system is responsible for the thermosensitive growth defect of an Escherichia coli mutant lacking phosphatidylglycerol and cardiolipin., J Bacteriol 186(19):6526-35

 [14] Zhang Z., Luo F., 2019, [Role of mGluR5 in laterocapcular division of central nucleus of amygdala in fentanyl-induced hyperalgesia in rats]., Zhong Nan Da Xue Xue Bao Yi Xue Ban 44(4):364-369

 [15] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [16] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB