RegulonDB RegulonDB 10.8: Gene Form
   

trmO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proS metQ trmO rcsF anti-anti-terminator anti-terminator terminator TSS_403 TSS_403 TSS_402 TSS_402 TSS_401 TSS_401 TSS_400 TSS_400 TSS_399 TSS_399 TSS_398 TSS_398 proSp proSp TSS_397 TSS_397 yaeFp1 yaeFp1

Gene      
Name: trmO    Texpresso search in the literature
Synonym(s): ECK0195, EG11503, b0195, tsaA, yaeB
Genome position(nucleotides): 218887 <-- 219594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.23
External database links:  
ASAP:
ABE-0000661
ECHOBASE:
EB1466
OU-MICROARRAY:
b0195
PortEco:
yaeB
STRING:
511145.b0195
COLOMBOS: trmO


Product      
Name: tRNA m6t6A37 methyltransferase
Synonym(s): TrmO, TsaA, YaeB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.362
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
23 -> 25 PRQ
127 -> 130 VDGT
194 -> 194 D
196 -> 196 R
22 -> 142 VPRQPGLVKSANGELHLIAPYNQADAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSLVELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0016426 - tRNA (adenine) methyltransferase activity
GO:0089715 - tRNA m6t6A37 methyltransferase activity
biological_process GO:0030488 - tRNA methylation
GO:0008033 - tRNA processing
GO:0032259 - methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11195N
ECOCYC:
EG11503-MONOMER
ECOLIWIKI:
b0195
INTERPRO:
IPR023370
INTERPRO:
IPR041369
INTERPRO:
IPR040372
INTERPRO:
IPR023368
INTERPRO:
IPR036413
INTERPRO:
IPR036414
PANTHER:
PTHR12818
PFAM:
PF01980
PFAM:
PF18389
PRIDE:
P28634
PROSITE:
PS01318
PROSITE:
PS51668
REFSEQ:
NP_414737
SMR:
P28634
UNIPROT:
P28634


Operon      
Name: rcsF-trmO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeFp1 217135 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_397 218831 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_398 220022 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_399 220386 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_400 220394 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_401 220539 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_402 220543 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_403 220638 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB