RegulonDB RegulonDB 10.8: Gene Form
   

mog gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

talB mog satP TSS_25 (cluster) TSS_25 (cluster) TSS_24 TSS_24 TSS_23 TSS_23

Gene      
Name: mog    Texpresso search in the literature
Synonym(s): ECK0009, EG11511, b0009, bisD, chlG, mogA, yaaG
Genome position(nucleotides): 9306 --> 9893 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.42
External database links:  
ASAP:
ABE-0000030
CGSC:
917
ECHOBASE:
EB1473
OU-MICROARRAY:
b0009
PortEco:
mog
STRING:
511145.b0009
COLOMBOS: mog


Product      
Name: molybdopterin adenylyltransferase
Synonym(s): BisD, ChlG, Mog, MogA, YaaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.222
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
82 -> 82 D
49 -> 49 D
8 -> 147 LVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0061598 - molybdopterin adenylyltransferase activity
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
GO:0032324 - molybdopterin cofactor biosynthetic process
External database links:  
DIP:
DIP-35784N
ECOCYC:
EG11511-MONOMER
ECOLIWIKI:
b0009
INTERPRO:
IPR001453
INTERPRO:
IPR036425
INTERPRO:
IPR008284
MINT:
MINT-1238245
MODBASE:
P0AF03
PDB:
1DI7
PDB:
1DI6
PFAM:
PF00994
PRIDE:
P0AF03
PROSITE:
PS01078
REFSEQ:
NP_414550
SMART:
SM00852
SMR:
P0AF03
SWISSMODEL:
P0AF03
UNIPROT:
P0AF03


Operon      
Name: mog         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_23 8352 forward nd [RS-EPT-CBR] [1]
  promoter TSS_24 8638 forward nd [RS-EPT-CBR] [1]
  promoter TSS_25 (cluster) 9277 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB