RegulonDB RegulonDB 10.7: Gene Form
   

satP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaaW mog satP mbiA htgAp1 htgAp1 htgAp2 htgAp2

Gene      
Name: satP    Texpresso search in the literature
Synonym(s): ECK0010, EG11512, b0010, yaaH
Genome position(nucleotides): 9928 <-- 10494 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.09
External database links:  
ASAP:
ABE-0000032
ECHOBASE:
EB1474
OU-MICROARRAY:
b0010
PORTECO:
yaaH
REGULONDB:
b0010
STRING:
511145.b0010
M3D: satP
COLOMBOS: satP
PortEco: b0010


Product      
Name: acetate/succinate:H+ symporter
Synonym(s): SatP, YaaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.071
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
4 -> 177 TKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQF
64 -> 84 FGLTAFTSYGSFWLTLVAILL
123 -> 143 VLQFVFFSLTVLFALLAIGNI
131 -> 131 L
164 -> 164 A

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0015360 - acetate:proton symporter activity
biological_process GO:0006811 - ion transport
GO:0071422 - succinate transmembrane transport
GO:0035433 - acetate transmembrane transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11512-MONOMER
ECOLIWIKI:
b0010
INTERPRO:
IPR000791
PDB:
5ZUG
PFAM:
PF01184
PRIDE:
P0AC98
PROSITE:
PS01114
PROTEINMODELPORTAL:
P0AC98
REFSEQ:
NP_414551
SMR:
P0AC98
UNIPROT:
P0AC98


Operon      
Name: satP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB