RegulonDB RegulonDB 10.6.3: Gene Form
   

gltF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gltD gltF yhcA yhcAp9 yhcAp9 yhcAp1 yhcAp1 yhcAp11 yhcAp11 TSS_3549 TSS_3549 TSS_3548 TSS_3548 TSS_3547 TSS_3547

Gene      
Name: gltF    Texpresso search in the literature
Synonym(s): ECK3204, EG11514, b3214, ossB
Genome position(nucleotides): 3361176 --> 3361940 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.36
External database links:  
ASAP:
ABE-0010549
CGSC:
18259
ECHOBASE:
EB1476
ECOCYC:
EG11514
ECOLIHUB:
gltF
OU-MICROARRAY:
b3214
REGULONDB:
b3214
STRING:
511145.b3214
M3D: gltF
COLOMBOS: gltF
PortEco: b3214


Product      
Name: periplasmic protein GltF
Synonym(s): GltF, OssB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 26.352
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
26 -> 254 TDSTDTELTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDTLVDMKGTKNAFGLGSAPNGQKIGAASIGIDRSNGGIHAADDTGEIPVDLIQTDHWSAATPTWKASSNGAFCSLTSCSAIERGYSVAKTGELTPVAITAVTFPLLIDAAVNDNTILGSDETIKLDGNVTISVQYL
1 -> 25 MFFKKNLTTAAICAALSVAAFSAMA
213 -> 229 PVAITAVTFPLLIDAAV
33 -> 146 LTIIGEYTPGACTPVVTGGGIVDYGKHHNSALNPTGKSNKLVQLGRKNSTLNITCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDTLVDMKGTKNAFGLGSAPNGQKIGAAS

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11514-MONOMER
ECOLIWIKI:
b3214
INTERPRO:
IPR010546
PFAM:
PF06551
PRIDE:
P28721
PRODB:
PRO_000022806
PROTEINMODELPORTAL:
P28721
REFSEQ:
NP_417681
UNIPROT:
P28721


Operon      
Name: gltBDF         
Operon arrangement:
Transcription unit        Promoter
gltBDF


Transcriptional Regulation      
Display Regulation             
Activated by: HdfR, IHF, Lrp, GadE, AdiY
Repressed by: CRP, Nac, Fur, FNR, ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3547 3359356 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3548 3359426 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3549 3359434 forward nd [RS-EPT-CBR] [1]
  promoter yhcAp11 3361978 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhcAp1 3362039 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhcAp9 3362094 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB