RegulonDB RegulonDB 10.8: Gene Form
   

ybfC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybfO ybfC ybfB ybfQ TSS_831 TSS_831

Gene      
Name: ybfC    Texpresso search in the literature
Synonym(s): ECK0692, EG11523, b0704
Genome position(nucleotides): 735650 --> 736219 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.67
External database links:  
ASAP:
ABE-0002404
ECHOBASE:
EB1485
OU-MICROARRAY:
b0704
PortEco:
ybfC
STRING:
511145.b0704
COLOMBOS: ybfC


Product      
Name: uncharacterized protein YbfC
Synonym(s): YbfC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.961
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
20 -> 189 DCEIQAKDHDCFTIFAKGTIFSAFPVLNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPVQLLAVLDNSIMVKYFKDEKPTYARMTAHLPNKNESYECLIKIQHELIRSEEK
1 -> 19 MKRVLFFLLMIFVSFGVIA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11523-MONOMER
ECOLIWIKI:
b0704
PRIDE:
P28915
REFSEQ:
NP_415232
SMR:
P28915
UNIPROT:
P28915


Operon      
Name: ybfOC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_831 734988 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB