RegulonDB RegulonDB 10.7: Gene Form
   

ychH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dauA pth ychH CRP terminator anti-terminator anti-anti-terminator TSS_1537 TSS_1537 TSS_1536 TSS_1536 ychHp ychHp pthp pthp

Gene      
Name: ychH    Texpresso search in the literature
Synonym(s): ECK1193, EG11533, b1205
Genome position(nucleotides): 1258791 --> 1259069 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0004049
ECHOBASE:
EB1495
OU-MICROARRAY:
b1205
PORTECO:
ychH
REGULONDB:
b1205
STRING:
511145.b1205
M3D: ychH
COLOMBOS: ychH
PortEco: b1205


Product      
Name: stress-induced protein
Synonym(s): YchH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.486
Isoelectric point: 10.804
Motif(s):
 
Type Positions Sequence
1 -> 87 MKRKNASLLGNVLMGLGLVVMVVGVGYSILNQLPQFNMPQYFAHGAVLSIFVGAILWLAGARVGGHEQVCDRYWWVRHYDKRCRRSD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
biological_process GO:0070301 - cellular response to hydrogen peroxide
GO:0044011 - single-species biofilm formation on inanimate substrate
GO:0071276 - cellular response to cadmium ion
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lee J., et al., 2010
[2] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG11533-MONOMER
ECOLIWIKI:
b1205
INTERPRO:
IPR019698
PFAM:
PF10762
PRIDE:
P0AB49
PROTEINMODELPORTAL:
P0AB49
REFSEQ:
NP_415723
UNIPROT:
P0AB49


Operon      
Name: ychH         
Operon arrangement:
Transcription unit        Promoter
ychH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1536 1258938 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1537 1259525 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lee J., Hiibel SR., Reardon KF., Wood TK., 2010, Identification of stress-related proteins in Escherichia coli using the pollutant cis-dichloroethylene., J Appl Microbiol 108(6):2088-102

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB