RegulonDB RegulonDB 10.9: Gene Form
   

ibpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ibpB ibpA yidQ CpxR CpxR CpxR IHF Cis-reg; thermoregulator yidQp yidQp ibpAp ibpAp ibpBp ibpBp

Gene      
Name: ibpA    Texpresso search in the literature
Synonym(s): ECK3679, EG11534, b3687, hslT, htpN
Genome position(nucleotides): 3867009 <-- 3867422 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.1
External database links:  
ASAP:
ABE-0012058
CGSC:
33847
ECHOBASE:
EB1496
ECOLIHUB:
ibpA
OU-MICROARRAY:
b3687
STRING:
511145.b3687
COLOMBOS: ibpA


Product      
Name: small heat shock protein IbpA
Synonym(s): HslT, HtpN, IbpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.774
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
42 -> 137 VDENHYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYIDLERVIPEAKKPRRIEIN
28 -> 137 SQSNGGYPPYNVELVDENHYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYIDLERVIPEAKKPRRIEIN

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009408 - response to heat
GO:0050821 - protein stabilization
External database links:  
DIP:
DIP-47849N
ECOCYC:
EG11534-MONOMER
ECOLIWIKI:
b3687
INTERPRO:
IPR002068
INTERPRO:
IPR008978
INTERPRO:
IPR023728
INTERPRO:
IPR037913
MINT:
P0C054
MODBASE:
P0C054
PFAM:
PF00011
PRIDE:
P0C054
PRODB:
PRO_000022981
PROSITE:
PS01031
REFSEQ:
NP_418142
SMR:
P0C054
UNIPROT:
P0C054


Operon      
Name: ibpAB         
Operon arrangement:
Transcription unit        Promoter
ibpB
ibpAB


RNA cis-regulatory element    
   
Cis-reg; thermoregulator Repression of heat shock gene expression (ROSE) element
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB