RegulonDB RegulonDB 10.8: Gene Form
   

tesA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybbP cnoX ybbO ybbA tesA anti-anti-terminator anti-terminator terminator tesAp tesAp TSS_664 TSS_664 ybbOp4 ybbOp4 TSS_663 TSS_663 ybbNp2 ybbNp2 ybbNp1 ybbNp1 TSS_662 (cluster) TSS_662 (cluster) TSS_661 TSS_661

Gene      
Name: tesA    Texpresso search in the literature
Synonym(s): ECK0488, EG11542, apeA, b0494, pldC
Genome position(nucleotides): 519139 <-- 519765 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.79
External database links:  
ASAP:
ABE-0001713
CGSC:
31102
ECHOBASE:
EB1504
OU-MICROARRAY:
b0494
PortEco:
tesA
STRING:
511145.b0494
COLOMBOS: tesA


Product      
Name: multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Synonym(s): ApeA, PldC, TesA, acyl-CoA thioesterase I, lecithinase B, long chain fatty acyl thioesterase I, lysophospholipase L1, phospholipase B, thioesterase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 23.622
Isoelectric point: 7.834
Motif(s):
 
Type Positions Sequence
1 -> 26 MMNFNNVFRWHLPFLFLVLLTFRAAA
33 -> 187 LGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRD
70 -> 70 G
135 -> 135 L
27 -> 208 ADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016297 - acyl-[acyl-carrier-protein] hydrolase activity
GO:0016295 - myristoyl-[acyl-carrier-protein] hydrolase activity
GO:0004064 - arylesterase activity
GO:0102991 - myristoyl-CoA hydrolase activity
GO:0004320 - oleoyl-[acyl-carrier-protein] hydrolase activity
GO:0016296 - palmitoyl-[acyl-carrier-protein] hydrolase activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0016298 - lipase activity
GO:0004622 - lysophospholipase activity
GO:0016290 - palmitoyl-CoA hydrolase activity
GO:0042802 - identical protein binding
GO:0047617 - acyl-CoA hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0006629 - lipid metabolic process
External database links:  
ECOCYC:
THIOESTERI-MONOMER
ECOLIWIKI:
b0494
INTERPRO:
IPR013830
INTERPRO:
IPR036514
INTERPRO:
IPR008265
MODBASE:
P0ADA1
PDB:
1U8U
PDB:
1V2G
PDB:
5TIC
PDB:
5TID
PDB:
5TIF
PDB:
1JRL
PDB:
5TIE
PDB:
1J00
PDB:
1IVN
PFAM:
PF13472
PRIDE:
P0ADA1
PRODB:
PRO_000024048
PROSITE:
PS01098
REFSEQ:
NP_415027
SMR:
P0ADA1
SWISSMODEL:
P0ADA1
UNIPROT:
P0ADA1


Operon      
Name: tesA-ybbO         
Operon arrangement:
Transcription unit        Promoter
tesA-ybbO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_661 518264 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_662 (cluster) 518306 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter ybbNp2 518568 reverse The sigma factor was determined
Read more >
[AIPP] [2]
  promoter TSS_663 518661 reverse nd [RS-EPT-CBR] [1]
  promoter ybbOp4 519329 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_664 519797 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Zhao K., Liu M., Burgess RR., 2005, The global transcriptional response of Escherichia coli to induced sigma 32 protein involves sigma 32 regulon activation followed by inactivation and degradation of sigma 32 in vivo., J Biol Chem 280(18):17758-68

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB