RegulonDB RegulonDB 10.8: Gene Form
   

flgL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rne flgK flgL flgL3\' TSS_1363 TSS_1363 TSS_1362 TSS_1362 TSS_1361 TSS_1361 TSS_1360 TSS_1360 TSS_1359 TSS_1359 TSS_1358 TSS_1358 TSS_1357 TSS_1357 TSS_1356 TSS_1356 TSS_1355 TSS_1355 TSS_1354 TSS_1354 TSS_1353 TSS_1353 TSS_1352 (cluster) TSS_1352 (cluster) TSS_1351 TSS_1351 TSS_1350 TSS_1350 TSS_1349 TSS_1349

Gene      
Name: flgL    Texpresso search in the literature
Synonym(s): ECK1068, EG11545, b1083, flaT
Genome position(nucleotides): 1140033 --> 1140986 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.73
External database links:  
ASAP:
ABE-0003666
CGSC:
757
ECHOBASE:
EB1507
OU-MICROARRAY:
b1083
PortEco:
flgL
STRING:
511145.b1083
COLOMBOS: flgL


Product      
Name: flagellar hook-filament junction protein 2
Synonym(s): FlaT, FlgL
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,cell projection
Molecular weight: 34.281
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
168 -> 168 R
4 -> 141 STQMMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDDPIAASQAVVLSQAQAQNSQYTLARTFATQKVSLEESVLSQVTTAIQNAQEKIVYASNGTLSDDDRASLATDIQGLRDQLLNLANTTDGNGRYIFAGYKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
molecular_function GO:0005198 - structural molecule activity
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Fahrner KA., et al., 1994
External database links:  
ECOCYC:
EG11545-MONOMER
ECOLIWIKI:
b1083
INTERPRO:
IPR001029
INTERPRO:
IPR013384
MODBASE:
P29744
PFAM:
PF00669
PRIDE:
P29744
PRODB:
PRO_000022647
REFSEQ:
NP_415601
SMR:
P29744
UNIPROT:
P29744


Operon      
Name: flgKL         
Operon arrangement:
Transcription unit        Promoter
flgK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1349 1140510 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1350 1140515 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1351 1140518 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1352 (cluster) 1141491 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1353 1141695 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1354 1141698 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1355 1141705 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1356 1141797 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1357 1142026 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1358 1142028 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1359 1142031 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1360 1142313 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1361 1143233 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1362 1144355 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1363 1144358 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Fahrner KA., Block SM., Krishnaswamy S., Parkinson JS., Berg HC., 1994, A mutant hook-associated protein (HAP3) facilitates torsionally induced transformations of the flagellar filament of Escherichia coli., J Mol Biol 238(2):173-86

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB