RegulonDB RegulonDB 10.7: Gene Form
   

hydN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hypF ascG hydN Cra anti-anti-terminator anti-terminator terminator hydNp hydNp hypFp3 hypFp3 hypFp2 hypFp2

Gene      
Name: hydN    Texpresso search in the literature
Synonym(s): ECK2708, EG11552, b2713
Genome position(nucleotides): 2837578 <-- 2838105 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.27
External database links:  
ASAP:
ABE-0008919
CGSC:
33521
ECHOBASE:
EB1513
OU-MICROARRAY:
b2713
PORTECO:
hydN
REGULONDB:
b2713
STRING:
511145.b2713
M3D: hydN
COLOMBOS: hydN
PortEco: b2713


Product      
Name: putative electron transport protein HydN
Synonym(s): HydN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.026
Isoelectric point: 7.951
Motif(s):
 
Type Positions Sequence
55 -> 104 ATVCRQCEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAM
2 -> 32 NRFIIADASKCIGCRTCEVACVVSHQENQDC
80 -> 109 GFVHVMQERCIGCKTCVVACPYGAMEVVVR
10 -> 22 SKCIGCRTCEVAC
124 -> 157 DKAEANKCDLCNHREDGPACMAACPTHALICVDR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0042802 - identical protein binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Maier T., et al., 1996
External database links:  
ECOCYC:
EG11552-MONOMER
ECOLIWIKI:
b2713
INTERPRO:
IPR017896
INTERPRO:
IPR017900
MODBASE:
P0AAK4
PFAM:
PF12798
PFAM:
PF12800
PFAM:
PF13247
PRIDE:
P0AAK4
PRODB:
PRO_000022962
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P0AAK4
REFSEQ:
NP_417193
SMR:
P0AAK4
SWISSMODEL:
P0AAK4
UNIPROT:
P0AAK4


Operon      
Name: hydN-hypF         
Operon arrangement:
Transcription unit        Promoter
hypF
hypF
hydN-hypF
hypF


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FlhDC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Maier T., Binder U., Bock A., 1996, Analysis of the hydA locus of Escherichia coli: two genes (hydN and hypF) involved in formate and hydrogen metabolism., Arch Microbiol 165(5):333-41


RegulonDB