RegulonDB RegulonDB 10.6.3: Gene Form
   

stpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaP alaE stpA Lrp Lrp Lrp alaEp11 alaEp11 alaEp alaEp alaEp1 alaEp1 stpAp3 stpAp3 stpAp2 stpAp2 stpAp1 stpAp1

Gene      
Name: stpA    Texpresso search in the literature
Synonym(s): ECK2663, EG11554, b2669, hnsB
Genome position(nucleotides): 2798091 <-- 2798495 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0008788
CGSC:
34492
ECHOBASE:
EB1515
ECOCYC:
EG11554
ECOLIHUB:
stpA
OU-MICROARRAY:
b2669
REGULONDB:
b2669
STRING:
511145.b2669
M3D: stpA
COLOMBOS: stpA
PortEco: b2669


Product      
Name: DNA-binding transcriptional repressor StpA with RNA chaperone activity
Synonym(s): H-NS-like DNA-binding transcriptional repressor with RNA chaperone activity, HnsB, StpA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HNS
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 15.347
Isoelectric point: 9.033
Motif(s):
 
Type Positions Sequence
112 -> 117 QGRTPK
38 -> 128 KERREEEEQQQRELAERQEKISTWLELMKADGINPEELLGNSSAAAPRAGKKRQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKS
65 -> 134 MKADGINPEELLGNSSAAAPRAGKKRQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI
26 -> 26 L
42 -> 45 EEEE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0032993 - protein-DNA complex
molecular_function GO:0003680 - AT DNA binding
GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0003681 - bent DNA binding
GO:0046983 - protein dimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0016458 - gene silencing
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-35951N
ECOCYC:
EG11554-MONOMER
ECOLIWIKI:
b2669
INTERPRO:
IPR001801
INTERPRO:
IPR037150
INTERPRO:
IPR027454
INTERPRO:
IPR027444
MINT:
MINT-1247857
MODBASE:
P0ACG1
PDB:
2LRX
PFAM:
PF00816
PRIDE:
P0ACG1
PRODB:
PRO_000024001
PROTEINMODELPORTAL:
P0ACG1
REFSEQ:
NP_417155
SMART:
SM00528
SMR:
P0ACG1
UNIPROT:
P0ACG1


Operon      
Name: stpA         
Operon arrangement:
Transcription unit        Promoter
stpA
stpA
stpA


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp
Repressed by: H-NS, StpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter alaEp1 2799070 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter alaEp11 2799087 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB