RegulonDB RegulonDB 10.7: Gene Form
   

caiD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

caiC caiD caiE caiEp3 caiEp3 caiEp5 caiEp5 caiEp7 caiEp7

Gene      
Name: caiD    Texpresso search in the literature
Synonym(s): ECK0037, EG11557, b0036, yaaL
Genome position(nucleotides): 35377 <-- 36162 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.07
External database links:  
ASAP:
ABE-0000130
CGSC:
36831
ECHOBASE:
EB1518
OU-MICROARRAY:
b0036
PORTECO:
caiD
REGULONDB:
b0036
STRING:
511145.b0036
M3D: caiD
COLOMBOS: caiD
PortEco: b0036


Product      
Name: crotonobetainyl-CoA hydratase
Synonym(s): CaiD, YaaL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.19
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
9 -> 260 RNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKG
2 -> 261 SESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKGR
247 -> 247 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.22 - carnitine metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016836 - hydro-lyase activity
GO:0008809 - carnitine racemase activity
biological_process GO:0009437 - carnitine metabolic process
GO:0042413 - carnitine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CARNRACE-MONOMER
ECOLIWIKI:
b0036
INTERPRO:
IPR029045
INTERPRO:
IPR001753
INTERPRO:
IPR014748
INTERPRO:
IPR018376
INTERPRO:
IPR022852
MODBASE:
P31551
PFAM:
PF00378
PRIDE:
P31551
PRODB:
PRO_000022243
PROSITE:
PS00166
PROTEINMODELPORTAL:
P31551
REFSEQ:
NP_414578
SMR:
P31551
UNIPROT:
P31551


Operon      
Name: caiTABCDE         
Operon arrangement:
Transcription unit        Promoter
caiTABCDE
caiCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, ArcA, CaiF
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter caiEp7 35399 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter caiEp5 35440 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter caiEp3 35499 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB