RegulonDB RegulonDB 10.7: Gene Form
   

caiC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

caiC caiB caiD TSS_81 TSS_81 caiEp3 caiEp3 caiEp5 caiEp5 caiEp7 caiEp7

Gene      
Name: caiC    Texpresso search in the literature
Synonym(s): ECK0038, EG11558, b0037, yaaM
Genome position(nucleotides): 36271 <-- 37824 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.03
External database links:  
ASAP:
ABE-0000133
CGSC:
36828
ECHOBASE:
EB1519
OU-MICROARRAY:
b0037
PORTECO:
caiC
REGULONDB:
b0037
STRING:
511145.b0037
M3D: caiC
COLOMBOS: caiC
PortEco: b0037


Product      
Name: carnitine—CoA ligase
Synonym(s): CaiC, YaaM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 58.559
Isoelectric point: 5.69
Motif(s):
 
Type Positions Sequence
359 -> 359 R
17 -> 426 ADVYGHKTALICESSGGVVNRYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMPAFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMVQPPSANDQQHRLREVMFYLNLSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRPLPAGEIGEICIKGIPGKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRRCNMIKR
98 -> 98 C
286 -> 286 Q
435 -> 510 ELENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0016405 - CoA-ligase activity
GO:0016878 - acid-thiol ligase activity
GO:0051108 - carnitine-CoA ligase activity
GO:0051109 - crotonobetaine-CoA ligase activity
biological_process GO:0009437 - carnitine metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9243N
ECOCYC:
CAIC-MONOMER
ECOLIWIKI:
b0037
INTERPRO:
IPR042099
INTERPRO:
IPR023456
INTERPRO:
IPR020845
INTERPRO:
IPR000873
INTERPRO:
IPR025110
MODBASE:
P31552
PFAM:
PF13193
PFAM:
PF00501
PRIDE:
P31552
PROSITE:
PS00455
PROTEINMODELPORTAL:
P31552
REFSEQ:
NP_414579
SMR:
P31552
UNIPROT:
P31552


Operon      
Name: caiTABCDE         
Operon arrangement:
Transcription unit        Promoter
caiTABCDE
caiCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, ArcA, CaiF
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter caiEp7 35399 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter caiEp5 35440 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter caiEp3 35499 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_81 38400 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB