RegulonDB RegulonDB 10.8: Gene Form
   

caiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

caiT caiB caiA TSS_81 TSS_81

Gene      
Name: caiA    Texpresso search in the literature
Synonym(s): ECK0040, EG11560, b0039, yaaO
Genome position(nucleotides): 39244 <-- 40386 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0000139
CGSC:
36825
ECHOBASE:
EB1521
OU-MICROARRAY:
b0039
PortEco:
caiA
STRING:
511145.b0039
COLOMBOS: caiA


Product      
Name: crotonobetainyl-CoA reductase
Synonym(s): CaiA, YaaO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 42.558
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
6 -> 108 NDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKALADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQEQIDK
123 -> 215 AITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTPYIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDV
227 -> 376 GNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQEKFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVGIAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.22 - carnitine metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0003995 - acyl-CoA dehydrogenase activity
GO:0052890 - oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
biological_process GO:0009437 - carnitine metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Arense P., et al., 2013
[2] Elssner T., et al., 2001
External database links:  
DIP:
DIP-9241N
ECOCYC:
CROBETREDUCT-MONOMER
ECOLIWIKI:
b0039
INTERPRO:
IPR009100
INTERPRO:
IPR037069
INTERPRO:
IPR036250
INTERPRO:
IPR023450
INTERPRO:
IPR006089
INTERPRO:
IPR006091
INTERPRO:
IPR009075
INTERPRO:
IPR013786
MODBASE:
P60584
PFAM:
PF00441
PFAM:
PF02771
PFAM:
PF02770
PRIDE:
P60584
PRODB:
PRO_000022241
PROSITE:
PS00072
PROSITE:
PS00073
REFSEQ:
NP_414581
SMR:
P60584
UNIPROT:
P60584


Operon      
Name: caiTABCDE         
Operon arrangement:
Transcription unit        Promoter
caiTABCDE
caiCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, ArcA, CaiF
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_81 38400 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Arense P., Bernal V., Charlier D., Iborra JL., Foulquie-Moreno MR., Canovas M., 2013, Metabolic engineering for high yielding L(-)-carnitine production in Escherichia coli., Microb Cell Fact 12:56

 [2] Elssner T., Engemann C., Baumgart K., Kleber HP., 2001, Involvement of coenzyme A esters and two new enzymes, an enoyl-CoA hydratase and a CoA-transferase, in the hydration of crotonobetaine to L-carnitine by Escherichia coli., Biochemistry 40(37):11140-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB