RegulonDB RegulonDB 10.7: Gene Form
   

fixB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fixC fixB fixA fixX terminator

Gene      
Name: fixB    Texpresso search in the literature
Synonym(s): ECK0043, EG11563, b0042, yaaR
Genome position(nucleotides): 43188 --> 44129 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.69
External database links:  
ASAP:
ABE-0000147
ECHOBASE:
EB1524
MIM:
231680
OU-MICROARRAY:
b0042
PORTECO:
fixB
REGULONDB:
b0042
STRING:
511145.b0042
M3D: fixB
COLOMBOS: fixB
PortEco: b0042


Product      
Name: putative electron transfer flavoprotein FixB
Synonym(s): FixB, YaaR, putative electron transfer flavoprotein, NAD/FAD-binding domain and ETFP adenine nucleotide-binding domain-like
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.513
Isoelectric point: 7.146
Motif(s):
 
Type Positions Sequence
190 -> 274 VDLDKARLVVSVGRGIGSKENIALAEQLCKAIGAELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANAS
42 -> 169 AQAIQLGANHVWKLNGKPDDRMIEDYAGVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLKAAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTGETHTVE
255 -> 283 LYLAVGISGQIQHMVGANASQTIFAINKD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
biological_process GO:0009437 - carnitine metabolic process
GO:0042413 - carnitine catabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0033539 - fatty acid beta-oxidation using acyl-CoA dehydrogenase
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Eichler K., et al., 1995
[2] Walt A., et al., 2002
External database links:  
DIP:
DIP-9621N
ECOCYC:
EG11563-MONOMER
ECOLIWIKI:
b0042
INTERPRO:
IPR014729
INTERPRO:
IPR001308
INTERPRO:
IPR029035
INTERPRO:
IPR014730
INTERPRO:
IPR014731
INTERPRO:
IPR018206
INTERPRO:
IPR023461
MINT:
MINT-1240082
MODBASE:
P31574
PFAM:
PF01012
PFAM:
PF00766
PRIDE:
P31574
PRODB:
PRO_000022629
PROSITE:
PS00696
PROTEINMODELPORTAL:
P31574
REFSEQ:
NP_414584
SMART:
SM00893
SMR:
P31574
UNIPROT:
P31574


Operon      
Name: fixABCX         
Operon arrangement:
Transcription unit        Promoter
fixABCX


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, CaiF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Eichler K., Buchet A., Bourgis F., Kleber HP., Mandrand-Berthelot MA., 1995, The fix Escherichia coli region contains four genes related to carnitine metabolism., J Basic Microbiol 35(4):217-27

 [2] Walt A., Kahn ML., 2002, The fixA and fixB genes are necessary for anaerobic carnitine reduction in Escherichia coli., J Bacteriol 184(14):4044-7


RegulonDB