RegulonDB RegulonDB 10.8: Gene Form
   

thiQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiP thiB yabI thiQ thiQp2 thiQp2

Gene      
Name: thiQ    Texpresso search in the literature
Synonym(s): ECK0067, EG11572, b0066, sfuC, yabJ
Genome position(nucleotides): 72229 <-- 72927 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.08
External database links:  
ASAP:
ABE-0000244
ECHOBASE:
EB1532
OU-MICROARRAY:
b0066
PortEco:
thiQ
STRING:
511145.b0066
COLOMBOS: thiQ


Product      
Name: thiamine ABC transporter ATP binding subunit
Synonym(s): SfuC, ThiQ, YabJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.999
Isoelectric point: 9.37
Motif(s):
 
Type Positions Sequence
18 -> 157 FSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPF
130 -> 133 LSGG
213 -> 213 M
66 -> 66 M
150 -> 157 ILLLDEPF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0048502 - ATPase-coupled thiamine transmembrane transporter activity
GO:0015234 - thiamine transmembrane transporter activity
biological_process GO:0015888 - thiamine transport
GO:0071934 - thiamine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
SFUC-MONOMER
ECOLIWIKI:
b0066
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR005968
INTERPRO:
IPR003593
MODBASE:
P31548
PANTHER:
PTHR24220:SF26
PFAM:
PF00005
PRIDE:
P31548
PRODB:
PRO_000024064
PROSITE:
PS51288
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_414608
SMART:
SM00382
SMR:
P31548
UNIPROT:
P31548


Operon      
Name: sgrR-sroA-thiBPQ         
Operon arrangement:
Transcription unit        Promoter
sroA
sgrR-sroA-thiBPQ


Transcriptional Regulation      
Display Regulation             
Repressed by: SgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter thiQp2 73085 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB