RegulonDB RegulonDB 10.8: Gene Form
   

thiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiP thiB thiQ sroA Cis-reg; riboswitch terminator sroAp sroAp thiQp2 thiQp2

Gene      
Name: thiB    Texpresso search in the literature
Synonym(s): ECK0069, EG11574, b0068, sfuA, tbpA, yabL
Genome position(nucleotides): 74497 <-- 75480 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0000249
CGSC:
34691
ECHOBASE:
EB1534
OU-MICROARRAY:
b0068
PortEco:
tbpA
STRING:
511145.b0068
COLOMBOS: thiB


Product      
Name: thiamine ABC transporter periplasmic binding protein
Synonym(s): SfuA, TBP, TbpA, ThiB, YabL
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 36.163
Isoelectric point: 7.278
Motif(s):
 
Type Positions Sequence
215 -> 218 YTTS
1 -> 12 MLKKCLPLLLLC
73 -> 293 NSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGF
19 -> 327 KPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR
161 -> 162 ST

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0030976 - thiamine pyrophosphate binding
GO:0030975 - thiamine binding
biological_process GO:0015888 - thiamine transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Bastet L., et al., 2017
[2] Iwashima A., et al., 1971
[3] Matsuura A., et al., 1973
[4] Nishimune T., et al., 1973
[5] Rodionov DA., et al., 2002
External database links:  
DIP:
DIP-10967N
ECOCYC:
SFUA-MONOMER
ECOLIWIKI:
b0068
INTERPRO:
IPR005948
INTERPRO:
IPR005967
INTERPRO:
IPR006061
MODBASE:
P31550
PDB:
2QRY
PFAM:
PF13343
PRIDE:
P31550
PRODB:
PRO_000024051
PROSITE:
PS01037
REFSEQ:
NP_414610
SMR:
P31550
UNIPROT:
P31550


Operon      
Name: sgrR-sroA-thiBPQ         
Operon arrangement:
Transcription unit        Promoter
sroA
sgrR-sroA-thiBPQ


Transcriptional Regulation      
Display Regulation             
Repressed by: SgrR


RNA cis-regulatory element    
Attenuation: Translational
   
Cis-reg; riboswitch TPP riboswitch (THI element)
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter thiQp2 73085 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bastet L., Chauvier A., Singh N., Lussier A., Lamontagne AM., Prevost K., Masse E., Wade JT., Lafontaine DA., 2017, Translational control and Rho-dependent transcription termination are intimately linked in riboswitch regulation., Nucleic Acids Res 45(12):7474-7486

 [2] Iwashima A., Matsuura A., Nose Y., 1971, Thiamine-binding protein of Escherichia coli., J Bacteriol 108(3):1419-21

 [3] Matsuura A., Iwashima A., Nose Y., 1973, Purification of thiamine-binding protein from Escherichia coli., Biochem Biophys Res Commun 51(1):241-6

 [4] Nishimune T., Hayashi R., 1973, Purification and some properties of thiamine-binding protein of Escherichia coli., Biochim Biophys Acta 328(1):124-32

 [5] Rodionov DA., Vitreschak AG., Mironov AA., Gelfand MS., 2002, Comparative genomics of thiamin biosynthesis in procaryotes. New genes and regulatory mechanisms., J Biol Chem 277(50):48949-59

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB